Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C410001-50 50 µl $255 
LS-C410001-100 100 µl $315 
LS-C410001-200 200 µl $425 
HIST1H4B Antibody - Western blot analysis of extracts of mouse brain cells.

HIST1H4B Antibody LS‑C410001

HIST1H4B Antibody LS‑C410001

Antibody:
Rabbit Polyclonal to Human HIST1H4B
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$255 
LS-C410001-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human HIST1H4B
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
HIST1H4B antibody LS-C410001 is an unconjugated rabbit polyclonal antibody to mouse HIST1H4B. Validated for WB.
Target
Human HIST1H4B
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human HIST1H4B (NP_001029249.1). MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Specificity
Human HIST1H4B
Usage
The predicted MW is 11kDa, while the observed MW by Western blot was 15kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HIST1H4B

Publications (0)

Reviews (0)

Featured Products

HIST1H4B Antibody - Western blot analysis of extracts of various cell lines, using HIST1H4B antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
Species: Human, Mouse, Rat
Applications: IHC, Western blot, Flow Cytometry
BMP2 Antibody - Anti-BMP2 antibody IHC of human colon, epithelium. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
TNF Alpha ELISA Kit
Reactivity: Human
Range: 15.625-1000 pg/ml
TM4SF1 Antibody - Anti-TM4SF1 antibody IHC of human uterus, vessels. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA

Requested From: United States
Date Requested: 10/17/2019