Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C746982-20 20 µl $253 
LS-C746982-50 50 µl $279 
LS-C746982-100 100 µl $333 
LS-C746982-200 200 µl $429 
H2AFX / H2AX Antibody - Western blot analysis of extracts of various cell lines, using H2AFX antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.
H2AFX / H2AX Antibody - Immunoprecipitation analysis of 200ug extracts of HeLa cells, using 3 ug H2AFX antibody. Western blot was performed from the immunoprecipitate using H2AFX antibody at a dilition of 1:1000.
H2AFX / H2AX Antibody - Western blot analysis of extracts of various cell lines, using H2AFX antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.
H2AFX / H2AX Antibody - Immunoprecipitation analysis of 200ug extracts of HeLa cells, using 3 ug H2AFX antibody. Western blot was performed from the immunoprecipitate using H2AFX antibody at a dilition of 1:1000.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human H2AFX / H2AX Antibody (IF, WB) LS‑C746982

Polyclonal Rabbit anti‑Human H2AFX / H2AX Antibody (IF, WB) LS‑C746982

H2AFX / H2AX Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


H2AFX / H2AX Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


H2AX antibody LS-C746982 is an unconjugated rabbit polyclonal antibody to H2AX (H2AFX) from human. It is reactive with human, mouse and rat. Validated for IF, IP and WB.
Human H2AFX / H2AX
H2AFX | H2AX | Histone H2A.x | H2A.X | H2A histone family, member X | H2AX histone
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human H2AFX (NP_002096.1). VYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:50 - 1:100)
The predicted MW is 15kDa, while the observed MW by Western blot was 15kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About H2AFX / H2AX
P16104 NM_002105 NP_002096.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 1/23/2022