Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C490300-100 100 µg $435 
GSTA1+GSTA2+GSTA3+GSTA4+GSTA5 Antibody

GSTA1+GSTA2+GSTA3+GSTA4+GSTA5 Antibody LS‑C490300

GSTA1+GSTA2+GSTA3+GSTA4+GSTA5 Antibody LS‑C490300

Antibody:
Rabbit Polyclonal to Human GSTA1+GSTA2+GSTA3+GSTA4+GSTA5
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$435 
LS-C490300-100
100 µg
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human GSTA1+GSTA2+GSTA3+GSTA4+GSTA5
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
GSTA1+GSTA2+GSTA3+GSTA4+GSTA5 antibody LS-C490300 is an unconjugated rabbit polyclonal antibody to GSTA1+GSTA2+GSTA3+GSTA4+GSTA5 from human, mouse and rat. Validated for WB.
Target
Human GSTA1+GSTA2+GSTA3+GSTA4+GSTA5
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Immunoaffinity purified
Modifications
Unmodified
Applications
  • Western blot (0.1 - 0.5 µg/ml)
Immunogen
Amino acids MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE of human GSTA(1-5) were used as the immunogen for the GSTA antibody.
Presentation
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitution
Reconstitute in sterile distilled water.
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee

Publications (0)

Reviews (0)

Featured Products

GSTA1+GSTA2+GSTA3+GSTA4+GSTA5 Antibody - IHC analysis of GSTA1/A2/A3/A4/A5 using anti-GSTA1/A2/A3/A4/A5 antibody. GSTA1/A2/A3/A4/A5 was detected in paraffin-embedded section of human liver cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-GSTA1/A2/A3/A4/A5 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Species: Human
Applications: Western blot, ELISA
CTx-II ELISA Kit
Reactivity: Human
Range: 0.16-10 ng/ml
HTR7 / 5HT7 Receptor Antibody - Anti-5HT7 Receptor antibody IHC of human brain, cerebellum. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig
Applications: IHC, IHC - Paraffin, ELISA
IL2RA / CD25 Antibody - Immunofluorescence analysis of HeLa cells, using IL-2R alpha/CD25 (Phospho-Ser268) Antibody. The picture on the right is blocked with the phospho peptide.
Species: Human
Applications: Immunofluorescence, Western blot, Peptide Enzyme-Linked Immunosorbent Assay

Requested From: United States
Date Requested: 10/17/2019