Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
866-819-4732 (Toll Free North America
206-374-1102 (International)
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C747542-20 20 µl $215 
LS-C747542-50 50 µl $235 
LS-C747542-100 100 µl $295 
LS-C747542-200 200 µl $385 
GRN / Granulin Antibody - Immunohistochemistry of paraffin-embedded human prostate using GRN antibody at dilution of 1:100 (40x lens).
GRN / Granulin Antibody - Western blot analysis of extracts of various cell lines, using GRN antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
GRN / Granulin Antibody - Immunohistochemistry of paraffin-embedded human prostate using GRN antibody at dilution of 1:100 (40x lens).
GRN / Granulin Antibody - Western blot analysis of extracts of various cell lines, using GRN antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human GRN / Granulin Antibody (IHC, WB) LS‑C747542

Polyclonal Rabbit anti‑Human GRN / Granulin Antibody (IHC, WB) LS‑C747542

GRN / Granulin Rabbit anti-Human Polyclonal Antibody
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


GRN / Granulin Rabbit anti-Human Polyclonal Antibody
Unconjugated, Unmodified


Granulin antibody LS-C747542 is an unconjugated rabbit polyclonal antibody to human Granulin (GRN). Validated for IHC and WB.
Human GRN / Granulin
GRN | Acrogranin | CLN11 | Epithelin precursor | GEP | gp88 | Granulin | Granulin-epithelin | Granulins | PC cell-derived growth factor | PCDGF | PEPI | PGRN | Proepithelin | Progranulin
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 281-336 of human GRN (NP_002078.1). DVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCE
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
The predicted MW is 44kDa/46kDa/63kDa, while the observed MW by Western blot was 80kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About GRN / Granulin
P28799 NM_002087 NP_002078.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 1/28/2021