Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C749973-20 20 µl $253 
LS-C749973-50 50 µl $279 
LS-C749973-100 100 µl $333 
LS-C749973-200 200 µl $429 
GP6 / GPVI Antibody - Western blot analysis of extracts of various cell lines, using GP6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

Polyclonal Rabbit anti‑Human GP6 / GPVI Antibody (WB) LS‑C749973

Polyclonal Rabbit anti‑Human GP6 / GPVI Antibody (WB) LS‑C749973

Antibody:
GP6 / GPVI Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$253
LS-C749973-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
GP6 / GPVI Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
GPVI antibody LS-C749973 is an unconjugated rabbit polyclonal antibody to human GPVI (GP6). Validated for WB.
Target
Human GP6 / GPVI
Synonyms
GP6 | BDPLT11 | GPVI | Glycoprotein 6 | GPIV | Platelet collagen receptor | Platelet glycoprotein VI | Glycoprotein VI (platelet) | gp6
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-Terminus of human GP6 (NP_057447.4). LVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPQTRKSHGGQDGGRQDVHSRGLCS
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 35kDa/36kDa/67kDa, while the observed MW by Western blot was 55kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About GP6 / GPVI
Q9HCN6 NM_016363 NP_001077368.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/11/2021