LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
GNB2 Antibody LS‑C409957
GNB2 antibody LS-C409957 is an unconjugated rabbit polyclonal antibody to GNB2 from human, mouse and rat. Validated for WB.
Catalog
Size
Price
LS-C409957-50
50 µl
$255
LS-C409957-100
100 µl
$315
LS-C409957-200
200 µl
$425

Popular GNB2 Products

Antibody
Species: Human
Applications: IHC, Immunofluorescence, Western blot, ELISA
Immunohistochemistry of paraffin-embedded human small intestine tissue at dilution of 1:100
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Western blot of GNB2 antibody.
Species: Human, Pig
Applications: IHC, Western blot
Western blot All Lanes:GNB2 antibody at 1.87 ug/ml Lane 1: Mouse liver tissue Lane 2: Mouse lung tissue Lane 3: NIH/3T3 whole cell lysate Lane 4: Jurkat whole cell lysate Secondary Goat polyclonal to rabbit IgG at 1/10000 dilution Predicted band size: 38,26 kDa Observed band size: 37 kDa
Species: Human
Applications: Western blot, ELISA
Western blot of GNB2 antibody.
Species: Human, Pig
Applications: IHC, Western blot

Product Description

GNB2 antibody LS-C409957 is an unconjugated rabbit polyclonal antibody to GNB2 from human, mouse and rat. Validated for WB.

Specifications

Target
Human GNB2
Synonyms
GNB2, G protein subunit beta-2, G protein, beta-2 subunit, Transducin beta chain 2
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
GNB2 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human GNB2 (NP_005264.2). MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Specificity
Human GNB2
Usage
The predicted MW is 25kDa/37kDa, while the observed MW by Western blot was 37kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About GNB2
Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR. P62879 NM_005273 NP_005264.2


Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Requested From: United States
Date Requested: 11/12/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy