LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
GNAT2 Antibody LS‑C497061
GNAT2 antibody LS-C497061 is an unconjugated rabbit polyclonal antibody to human GNAT2. Validated for WB.
Catalog
Size
Price
LS-C497061-50
50 µl
$235
LS-C497061-100
100 µl
$295
LS-C497061-200
200 µl
$385

Popular GNAT2 Products

Antibody
Species: Human, Mouse
Applications: IHC, Western blot, ELISA
Antibody
Species: Human, Mouse
Applications: IHC, Western blot, ELISA
GNAT2 antibody immunohistochemistry of formalin-fixed and paraffin-embedded human Kidney tissue followed by peroxidase-conjugated secondary antibody and DAB staining.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot
IHC of G t2 (V34) pAb in paraffin-embedded human testis tissue.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot
Antibody
Species: Human, Mouse
Applications: IHC, Western blot, ELISA

Product Description

GNAT2 antibody LS-C497061 is an unconjugated rabbit polyclonal antibody to human GNAT2. Validated for WB.

Specifications

Target
Human GNAT2
Synonyms
GNAT2, ACHM4, GNATC, Transducin alpha-2 chain
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
GNAT2 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human GNAT2 (NP_005263.1). MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTC
Usage
The predicted MW is 40kDa, while the observed MW by Western blot was 45kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About GNAT2
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase. P19087 Z18859 CAA79310.1


Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of HepG2 cells, using GNAT2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.
Western blot analysis of extracts of HepG2 cells, using GNAT2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.

Western blot

Western blot analysis of extracts of HepG2 cells, using GNAT2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.
Western blot analysis of extracts of HepG2 cells, using GNAT2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.

Western blot

Western blot analysis of extracts of HepG2 cells, using GNAT2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.
Western blot analysis of extracts of HepG2 cells, using GNAT2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.

Western blot

Western blot analysis of extracts of HepG2 cells, using GNAT2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.
Western blot analysis of extracts of HepG2 cells, using GNAT2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 15s.

Requested From: United States
Date Requested: 11/14/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy