Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
GABRA2 Antibody LS‑C749196
GABRA2 antibody LS-C749196 is an unconjugated rabbit polyclonal antibody to GABRA2 from human, mouse and rat. Validated for WB.
50 µl
GABRA2 antibody LS-C749196 is an unconjugated rabbit polyclonal antibody to GABRA2 from human, mouse and rat. Validated for WB.
Human GABRA2
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
GABRA2 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 300-400 of human GABRA2 (NP_000798.2). ARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKP
The predicted MW is 51kDa/52kDa, while the observed MW by Western blot was 50kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About GABRA2
P47869 NM_000807 NP_000798.2

Popular GABRA2 Products

Immunohistochemical analysis of GABRA2 staining in rat brain formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot
GABRA2 Antibody IHC of formalin-fixed and paraffin-embedded brain tissue followed by peroxidase-conjugated secondary antibody and DAB staining.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
Species: Human
Applications: IHC, Western blot, Flow Cytometry, ELISA
Immunohistochemistry of paraffin-embedded human brain tissue at dilution of 1:100
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, ELISA
Species: Human
Applications: IHC, Western blot, Flow Cytometry, ELISA

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cell lines, using GABRA2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.
Western blot analysis of extracts of various cell lines, using GABRA2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.

Western blot

Western blot analysis of extracts of various cell lines, using GABRA2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.
Western blot analysis of extracts of various cell lines, using GABRA2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.

Western blot

Western blot analysis of extracts of various cell lines, using GABRA2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.
Western blot analysis of extracts of various cell lines, using GABRA2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.

Western blot

Western blot analysis of extracts of various cell lines, using GABRA2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.
Western blot analysis of extracts of various cell lines, using GABRA2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 3s.

Requested From: United States
Date Requested: 1/16/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy