Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

FUT1 / HSC Antibody (aa134-164) for IHC, WB/Western LS-C407806

HSC antibody LS-C407806 is an unconjugated rabbit polyclonal antibody to HSC (FUT1) from human, mouse and rat. Validated for IHC and WB.
100 µg
HSC antibody LS-C407806 is an unconjugated rabbit polyclonal antibody to HSC (FUT1) from human, mouse and rat. Validated for IHC and WB.
Human FUT1 / HSC
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
FUT1 / HSC antibody was raised against a synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL), different from the related mouse and rat sequences by seven amino acids.
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitute with 200 µl of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
About FUT1 / HSC
P19526 NM_000148 NP_000139.1

Popular FUT1 / HSC Products

Western blot of FUT1 antibody in CEM cell line lysates (35 ug/lane). FUT1 (arrow) was detected using the purified antibody.
Species: Human
Applications: Western blot, Flow Cytometry
Species: Mouse
Applications: Peptide Enzyme-Linked Immunosorbent Assay
Immunohistochemistry of Human gastric cancer using FUT1 Polyclonal Antibody at dilution of 1:30.
Species: Human
Applications: IHC, Western blot, ELISA
Immunohistochemistry - Paraffin Image
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot

Publications (0)

Customer Reviews (0)



FUT1 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.


FUT1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.


FUT1 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.

Western blot

FUT1 antibody Western blot. All lanes: Anti FUT1 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: SW620 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 50 kD. Observed band size: 50 kD.
FUT1 antibody Western blot. All lanes: Anti FUT1 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: SW620 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 50 kD. Observed band size: 50 kD.


FUT1 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.


FUT1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.


FUT1 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.

Western blot

FUT1 antibody Western blot. All lanes: Anti FUT1 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: SW620 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 50 kD. Observed band size: 50 kD.
FUT1 antibody Western blot. All lanes: Anti FUT1 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: SW620 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 50 kD. Observed band size: 50 kD.


FUT1 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.


FUT1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.


FUT1 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.

Western blot

FUT1 antibody Western blot. All lanes: Anti FUT1 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: SW620 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 50 kD. Observed band size: 50 kD.
FUT1 antibody Western blot. All lanes: Anti FUT1 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: SW620 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 50 kD. Observed band size: 50 kD.


FUT1 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.


FUT1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Human Mammary Cancer Tissue.


FUT1 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.
FUT1 antibody IHC-paraffin. IHC(P): Mouse Intestine Tissue.

Western blot

FUT1 antibody Western blot. All lanes: Anti FUT1 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: SW620 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 50 kD. Observed band size: 50 kD.
FUT1 antibody Western blot. All lanes: Anti FUT1 at 0.5 ug/ml. Lane 1: Rat Kidney Tissue Lysate at 50 ug. Lane 2: SW620 Whole Cell Lysate at 40 ug. Lane 3: A549 Whole Cell Lysate at 40 ug. Predicted band size: 50 kD. Observed band size: 50 kD.

Requested From: United States
Date Requested: 1/21/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy