Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C334387-20 20 µl $287 
LS-C334387-50 50 µl $329 
LS-C334387-100 100 µl $407 
LS-C334387-200 200 µl $509 
FUS / TLS Antibody - Western blot analysis of extract of various cells.

Polyclonal Rabbit anti‑Human FUS / TLS Antibody (WB) LS‑C334387

Polyclonal Rabbit anti‑Human FUS / TLS Antibody (WB) LS‑C334387

Antibody:
FUS / TLS Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$287
LS-C334387-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
FUS / TLS Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
TLS antibody LS-C334387 is an unconjugated rabbit polyclonal antibody to human TLS (FUS). Validated for WB.
Target
Human FUS / TLS
Synonyms
FUS | 75 kDa DNA-pairing protein | ALS6 | CHOP | FUS-CHOP | FUS1 | Fused in sarcoma | HnRNP-P2 | HNRNPP2 | Oncogene TLS | RNA-binding protein FUS | TLS | C/EBP-homologous protein | ETM4 | Fus-like protein | Oncogene FUS | POMP75
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 297-526 of human FUS (NP_004951.1). TIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Specificity
Human FUS / Gadd153
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 53kDa, while the observed MW by Western blot was 70kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About FUS / TLS
P35637 NM_004960 NP_004951.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/28/2022