Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
FPR2 / FPRL1 Antibody LS‑C662943
FPRL1 antibody LS-C662943 is an unconjugated rabbit polyclonal antibody to human FPRL1 (FPR2). Validated for IHC and WB.
100 µg

Popular FPR2 / FPRL1 Products

Immunofluorescence labeling of HL-60 cells using Formyl Peptide Receptor-like 1 (FPRL1, Formyl Peptide Receptor 2, FPR2, FMLP R I, FMLP R II, FMLP-related Receptor I, FMLPX, FPR2A, FPRH1, FPRH2, HM63, Lipoxin A4 Receptor, LXA4 Receptor, LXA4R, RFP) (green). Nuclei have been labeled with PI (red).
Species: Human
Applications: Immunofluorescence, Western blot, Flow Cytometry
Anti-FPR2 / FPRL1 antibody IHC of human spleen, neutrophils. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 20-40 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin
Anti-FPR2 / FPRL1 antibody IHC of human colon. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
Human Spleen: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin

Product Description

FPRL1 antibody LS-C662943 is an unconjugated rabbit polyclonal antibody to human FPRL1 (FPR2). Validated for IHC and WB.


Human FPR2 / FPRL1
FPR2, ALXR, FMLP-R-I, FMLP-related receptor I, Fpr-rs1, FPRL1, FPR-like 1, Fprl-1, HM63, FMLP-R-II, FMLPX, Formyl peptide receptor-like 1, FPR2A, FPRH1, FPRH2, LXA4 receptor, LXA4R, Lipoxin A4 receptor, Lipoxin receptor, N-formyl peptide receptor 2, Formyl peptide receptor 2
Human (tested or 100% immunogen sequence identity)
  • IHC
  • IHC - Paraffin
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
FPR2 / FPRL1 antibody was raised against a synthetic peptide corresponding to a sequence of human FPRL1 (TIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR).
Expressed abundantly in the lung and neutrophils. Also found in the spleen and testis.
4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3 per 100ug antibody
0.2ml of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
About FPR2 / FPRL1
FPRL1, a Chemoattractant Receptor also called Lipoxin A4 Receptor, functions as a component of the inflammatory response. Its stimulation results in neutrophil activation and desensitization of chemokine receptors in monocytes (Le et al., 2000). The receptor is up-regulated by interleukin-1 in normal human synovial fibroblasts. P25090 NM_001462 NP_001453.1

Publications (0)

Customer Reviews (0)


Immunohistochemistry - Paraffin

IHC analysis of FPRL1 using anti-FPRL1 antibody
IHC analysis of FPRL1 using anti-FPRL1 antibody

Immunohistochemistry - Paraffin

IHC analysis of FPRL1 using anti-FPRL1 antibody
IHC analysis of FPRL1 using anti-FPRL1 antibody

Western blot

Western blot analysis of FPRL1 using anti-FPRL1 antibody
Western blot analysis of FPRL1 using anti-FPRL1 antibody

Immunohistochemistry - Paraffin

IHC analysis of FPRL1 using anti-FPRL1 antibody
IHC analysis of FPRL1 using anti-FPRL1 antibody

Immunohistochemistry - Paraffin

IHC analysis of FPRL1 using anti-FPRL1 antibody
IHC analysis of FPRL1 using anti-FPRL1 antibody

Western blot

Western blot analysis of FPRL1 using anti-FPRL1 antibody
Western blot analysis of FPRL1 using anti-FPRL1 antibody

Immunohistochemistry - Paraffin

IHC analysis of FPRL1 using anti-FPRL1 antibody
IHC analysis of FPRL1 using anti-FPRL1 antibody

Immunohistochemistry - Paraffin

IHC analysis of FPRL1 using anti-FPRL1 antibody
IHC analysis of FPRL1 using anti-FPRL1 antibody

Western blot

Western blot analysis of FPRL1 using anti-FPRL1 antibody
Western blot analysis of FPRL1 using anti-FPRL1 antibody

Immunohistochemistry - Paraffin

IHC analysis of FPRL1 using anti-FPRL1 antibody
IHC analysis of FPRL1 using anti-FPRL1 antibody

Immunohistochemistry - Paraffin

IHC analysis of FPRL1 using anti-FPRL1 antibody
IHC analysis of FPRL1 using anti-FPRL1 antibody

Western blot

Western blot analysis of FPRL1 using anti-FPRL1 antibody
Western blot analysis of FPRL1 using anti-FPRL1 antibody

Requested From: United States
Date Requested: 11/12/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy