Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

FOXP3 Antibody

FOXP3 antibody LS-C408871 is an unconjugated rabbit polyclonal antibody to FOXP3 from human, mouse and rat. Validated for IHC and WB.
50 µl (1 mg/ml)
100 µl (1 mg/ml)
200 µl (1 mg/ml)
FOXP3 antibody LS-C408871 is an unconjugated rabbit polyclonal antibody to FOXP3 from human, mouse and rat. Validated for IHC and WB.
Human FOXP3
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
FOXP3 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 180-300 of human FOXP3 (NP_001107849.1). LKHCQADHLLDEKGRAQCLLQREMVQSLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHN
Human FOXP3
The predicted MW is 43kDa/44kDa/47kDa/49kDa, while the observed MW by Western blot was 47kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About FOXP3
Q9BZS1 NM_014009 NP_054728.2

Popular FOXP3 Products

FOXP3 antibody ARP32743_T100-NP_054728-FOXP3 (forkhead box P3) Antibody was used in IHC to stain formalin-fixed, paraffin-embedded human liver.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Rat, Bovine, Pig, Sheep
Applications: IHC, IHC - Paraffin, Western blot
Species: Mouse
Applications: ICC, Western blot, Flow Cytometry
IHC of FOXP3 on FFPE Tonsil tissue Intended Use For In Vitro Diagnostic Use.
Species: Human
Applications: IHC, IHC - Paraffin, IHC - Frozen
The same transfectants were stained with anti-Foxp3 antibody and HRPO-conjugated (upper panel) or Cy3-conjugated (lower panels) secondary antibody. Representative images (x100) are shown.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse, Human
Applications: ICC, Immunofluorescence, Western blot, Flow Cytometry
Species: Mouse
Applications: IHC, IHC - Frozen, Flow Cytometry

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 2/17/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy