LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
FOXA3 Antibody (aa291‑324) LS‑C408016
FOXA3 antibody LS-C408016 is an unconjugated rabbit polyclonal antibody to FOXA3 from human, mouse, dog and other species. Validated for WB.
Catalog
Size
Price
LS-C408016-100
100 µg
$325

Popular FOXA3 Products

Anti-FOXA3 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Bovine, Dog, Guinea pig, Pig, Rabbit, Zebrafish
Applications: IHC, IHC - Paraffin, Western blot
Detection limit for recombinant GST tagged FOXA3 is 0.03 ng/ml as a capture antibody.
Species: Human
Applications: Western blot, ELISA
WB using FOXA3 Antibody
Species: Mouse, Chimpanzee, Monkey, Rat, Dog, Pig
Applications: Western blot, Chromatin Immunoprecipitation
Anti-FOXA3 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Chimpanzee, Gibbon, Monkey, Bovine, Dog, Guinea pig, Pig, Rabbit, Zebrafish
Applications: IHC, IHC - Paraffin, Western blot
Anti-FOXA3 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Chimpanzee, Gibbon, Monkey, Bovine, Dog, Guinea pig, Pig, Rabbit, Zebrafish
Applications: IHC, IHC - Paraffin, Western blot

Product Description

FOXA3 antibody LS-C408016 is an unconjugated rabbit polyclonal antibody to FOXA3 from human, mouse, dog and other species. Validated for WB.

Specifications

Target
Human FOXA3
Synonyms
FOXA3, Forkhead box A3, HNF-3G, HNF3G, HNF-3-gamma, Forkhead box protein A3, TCF3G, TCF-3G, FKHH3, Transcription factor 3G
Host
Rabbit
Reactivity
Human, Mouse, Dog, Guinea pig, Horse, Pig (tested or 100% immunogen sequence identity)
Predicted
Hamster (at least 90% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • Western blot (0.1 - 0.5 µg/ml)
Immunogen
FOXA3 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.
Epitope
aa291-324
Specificity
Expressed in erythroleukemia and hepatoma cell lines and in liver and pancreas. Not expressed in any other cell lines or tissues examined. .
Presentation
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitution
Reconstitute with 200 µl of distilled water.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
Restrictions
For research use only.
About FOXA3
Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites (By similarity). Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. P55318 NM_004497 NP_004488.2


Publications (0)


Customer Reviews (0)


Images

Western blot

FOXA3 antibody Western blot. All lanes: Anti FOXA3 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Pancreas Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 37 kD. Observed band size: 37 kD.
FOXA3 antibody Western blot. All lanes: Anti FOXA3 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Pancreas Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 37 kD. Observed band size: 37 kD.

Western blot

FOXA3 antibody Western blot. All lanes: Anti FOXA3 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Pancreas Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 37 kD. Observed band size: 37 kD.
FOXA3 antibody Western blot. All lanes: Anti FOXA3 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Pancreas Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 37 kD. Observed band size: 37 kD.

Western blot

FOXA3 antibody Western blot. All lanes: Anti FOXA3 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Pancreas Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 37 kD. Observed band size: 37 kD.
FOXA3 antibody Western blot. All lanes: Anti FOXA3 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Pancreas Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 37 kD. Observed band size: 37 kD.

Western blot

FOXA3 antibody Western blot. All lanes: Anti FOXA3 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Pancreas Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 37 kD. Observed band size: 37 kD.
FOXA3 antibody Western blot. All lanes: Anti FOXA3 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Pancreas Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 37 kD. Observed band size: 37 kD.

Requested From: United States
Date Requested: 11/15/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy