Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

FOXA3 Antibody (aa291-324) LS-C408016

FOXA3 antibody Western blot. All lanes: Anti FOXA3 at 0.5 ug/ml. Lane 1: Rat Liver Tissue Lysate at 50 ug. Lane 2: Rat Pancreas Tissue Lysate at 50 ug. Lane 3: Mouse Liver Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 37 kD. Observed band size: 37 kD.

FOXA3 Antibody (aa291-324) LS-C408016

Rabbit Polyclonal to Human FOXA3
Human, Mouse, Dog, Guinea pig, Horse, Pig
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human FOXA3
Human, Mouse, Dog, Guinea pig, Horse, Pig
Unconjugated, Unmodified


FOXA3 antibody LS-C408016 is an unconjugated rabbit polyclonal antibody to FOXA3 from human, mouse, dog and other species. Validated for WB.

Human FOXA3
Human, Mouse, Dog, Guinea pig, Horse, Pig (tested or 100% immunogen sequence identity)
Hamster (at least 90% immunogen sequence identity)
Immunogen affinity purified
  • Western blot (0.1 - 0.5 µg/ml)
FOXA3 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.
Expressed in erythroleukemia and hepatoma cell lines and in liver and pancreas. Not expressed in any other cell lines or tissues examined. .
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitute with 200 µl of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About FOXA3
P55318 NM_004497 NP_004488.2

Publications (0)

Reviews (0)

Featured Products

Anti-CD11c antibody IHC of human colon, neutrophils. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human
Applications: IHC, IHC - Paraffin
Reactivity: Human
Range: 31.2-2000 pg/ml
Reactivity: Human
Range: 78.125-5000 pg/ml

Requested From: United States
Date Requested: 5/26/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy