LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

FGFR1 / FGF Receptor 1 Antibody LS‑C661917

Western blot - Anti-FGFR1 Picoband Antibody

FGFR1 / FGF Receptor 1 Antibody LS‑C661917

Antibody:
Goat Polyclonal to Human FGFR1 / FGF Receptor 1
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$325 
LS-C661917-100
Toll Free North America
866-819-4732

Overview

Antibody:
Goat Polyclonal to Human FGFR1 / FGF Receptor 1
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
FGF Receptor 1 antibody LS-C661917 is an unconjugated goat polyclonal antibody to human FGF Receptor 1 (FGFR1). Validated for WB.
Target
Human FGFR1 / FGF Receptor 1
Host
Goat
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • Western blot
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human FGFR1 (489-520 aa FGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDA), identical to the related mouse and rat sequences.
Specificity
Detected in astrocytoma, neuroblastoma and adrenal cortex cell lines. Some isoforms are detected in foreskin fibroblast cell lines, however isoform 17, isoform 18 and isoform 19 are not detected in these cells. .
Presentation
5mg BSA 0.9mg NaCl 0.2mg Na2HPO4 0.05mg NaN3 per 100ug antibody
Reconstitution
Reconstitute with 0.2ml distilled H2O.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About FGFR1 / FGF Receptor 1
P11362 NM_023110 CAA47375.1

Publications (0)

Reviews (0)

Featured Products

Anti-FABP1 antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Anti-LAG-3 antibody IHC of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: IHC, IHC - Paraffin, Flow Cytometry
Reactivity: Human
Range: 78.125-5000 pg/ml
Anti-SYNPO / Synaptopodin antibody IHC of human perivascular processes. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Reactivity: Human
Range: 0.94-60 ng/ml

Requested From: United States
Date Requested: 7/20/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy