Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

ESRRB / ERR Beta Antibody LS-C409951

ERR Beta antibody LS-C409951 is an unconjugated rabbit polyclonal antibody to mouse ERR Beta (ESRRB). Validated for WB.
50 µl
100 µl
200 µl
ERR Beta antibody LS-C409951 is an unconjugated rabbit polyclonal antibody to mouse ERR Beta (ESRRB). Validated for WB.
Human ESRRB / ERR Beta
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
Recombinant fusion protein containing a sequence corresponding to amino acids 434-508 of human ESRRB (NP_004443.3). GQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSPTPLNERGRQISPSTRTPGGQGKHLWLTM
Human ESRRB / ERR Beta
The predicted MW is 48kDa/55kDa/56kDa, while the observed MW by Western blot was 50kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About ESRRB / ERR Beta
O95718 NM_004452 NP_004443.3

Popular ESRRB / ERR Beta Products

Anti-ESRRB antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Monkey, Hamster, Horse
Applications: IHC, IHC - Paraffin
Anti-ESRRB / ERR Beta antibody IHC of human Lung, Small Cell Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Monkey, Bovine, Dog, Hamster, Horse, Pig, Rabbit
Applications: IHC, IHC - Paraffin
Anti-ESRRB / ERR-Beta antibody IHC of human uterus, endometrial glands. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1 ug/ml.
Species: Human, Monkey, Horse
Applications: IHC, IHC - Paraffin
Fetal Kidney Lysate.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig
Applications: Western blot
Immunohistochemistry of ESRR8 in human heart tissue with ESRR8 antibody at 5 ug/ml.
Species: Human
Applications: IHC, Immunofluorescence, Western blot, ELISA

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of mouse heart cells.
Western blot analysis of extracts of mouse heart cells.

Western blot

Western blot analysis of extracts of mouse heart cells.
Western blot analysis of extracts of mouse heart cells.

Western blot

Western blot analysis of extracts of mouse heart cells.
Western blot analysis of extracts of mouse heart cells.

Western blot

Western blot analysis of extracts of mouse heart cells.
Western blot analysis of extracts of mouse heart cells.

Requested From: United States
Date Requested: 2/19/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy