LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

ESRRB / ERR Beta Antibody LS-C409951

Western blot analysis of extracts of mouse heart cells.

ESRRB / ERR Beta Antibody LS-C409951

Antibody:
Rabbit Polyclonal to Human ESRRB / ERR Beta
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$235 
LS-C409951-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human ESRRB / ERR Beta
Application:
WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
ERR Beta antibody LS-C409951 is an unconjugated rabbit polyclonal antibody to mouse ERR Beta (ESRRB). Validated for WB.

Target
Human ESRRB / ERR Beta
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • Western blot (1:500 - 1:2000)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 434-508 of human ESRRB (NP_004443.3). GQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSPTPLNERGRQISPSTRTPGGQGKHLWLTM
Specificity
Human ESRRB / ERR Beta
Usage
The predicted MW is 48kDa/55kDa/56kDa, while the observed MW by Western blot was 50kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ESRRB / ERR Beta
O95718 NM_004452 NP_004443.3

Publications (0)

Reviews (0)

Featured Products

Flow cytometry of CD30 antibody This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: Flow Cytometry
Reactivity: Human
Range: 0.156-10 ng/ml
Western blot analysis of lysates from A431 cells, using phospho-CD167a (Phospho-Tyr792) antibody.
Species: Human, Mouse, Rat
Applications: Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Reactivity: Human
Range: 0.156-10 ng/ml

Requested From: United States
Date Requested: 6/17/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy