Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C334515-20 20 µl $263 
LS-C334515-50 50 µl $301 
LS-C334515-100 100 µl $359 
LS-C334515-200 200 µl $473 
ERCC6L / FLJ20105 Antibody - Western blot analysis of extracts of various cell lines, using ERCC6L antibody.

Polyclonal Rabbit anti‑Human ERCC6L / FLJ20105 Antibody (WB) LS‑C334515

Polyclonal Rabbit anti‑Human ERCC6L / FLJ20105 Antibody (WB) LS‑C334515

Antibody:
ERCC6L / FLJ20105 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C334515-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
ERCC6L / FLJ20105 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
FLJ20105 antibody LS-C334515 is an unconjugated rabbit polyclonal antibody to human FLJ20105 (ERCC6L). Validated for WB.
Target
Human ERCC6L / FLJ20105
Synonyms
ERCC6L | PICH | RAD26L | FLJ20105 | SNF2/RAD54 family protein | Tumor antigen BJ-HCC-15
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ERCC6L (NP_060139.2). KDATPGEKALGFKISENLMAIIKPYFLRRTKEDVQKKKSSNPEARLNEKNPDVDAICEMPSLSRKNDLIIWIRLVPLQEEIYRKFVSLDHIKELLMETRSP
Specificity
Human ERCC6L / FLJ20105.
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 141kDa, while the observed MW by Western blot was 223kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About ERCC6L / FLJ20105
Q2NKX8 AK000112 NP_060139.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/9/2022