Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331328-20 20 µl $263 
LS-C331328-50 50 µl $301 
LS-C331328-100 100 µl $359 
LS-C331328-200 200 µl $473 
EPCAM Antibody - Immunohistochemistry of paraffin-embedded human lung cancer using EPCAM antibodyat dilution of 1:100 (40x lens).
EPCAM Antibody - Western blot analysis of extracts of various cell lines, using EPCAM antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
EPCAM Antibody - Immunohistochemistry of paraffin-embedded human lung cancer using EPCAM antibodyat dilution of 1:100 (40x lens).
EPCAM Antibody - Western blot analysis of extracts of various cell lines, using EPCAM antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human EPCAM Antibody (IHC, WB) LS‑C331328

Polyclonal Rabbit anti‑Human EPCAM Antibody (IHC, WB) LS‑C331328

Antibody:
EPCAM Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C331328-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
EPCAM Rabbit anti-Human Polyclonal Antibody
Application:
IHC, WB
Reactivity:
Human, Mouse
Format:
Unconjugated, Unmodified

Specifications

Description
EPCAM antibody LS-C331328 is an unconjugated rabbit polyclonal antibody to EPCAM from human. It is reactive with human and mouse. Validated for IHC and WB. Cited in 1 publication.
Target
Human EPCAM
Synonyms
EPCAM | 323/A3 | ACSTD1 | 17-1A | CD326 | EGP | EGP34 | Epithelial glycoprotein | GA733-2 | HNPCC8 | Ep-CAM | ESA | HEGP314 | KS 1/4 antigen | KS1/4 | KSA | M1S2 | MIC18 | MK-1 | MH99 | TROP1 | TACST-1 | TACSTD1 | CD326 antigen | CO-17A | DIAR5 | EGP-2 | EGP314 | EGP40 | Epithelial glycoprotein 314 | HEA125 | Ly74 | M4S1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human EPCAM (NP_002345.2). VNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFS
Specificity
Human ESA / EPCAM
Applications
  • IHC (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 34kDa, while the observed MW by Western blot was 40kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About EPCAM
P16422 NM_002354 NP_002345.2

LSBio Ratings

EPCAM Antibody for IHC, WB/Western LS-C331328 has an LSBio Rating of
Publications (4)

Publications (1)

Characterization of preneoplastic and neoplastic rat mesothelial cell lines: the involvement of TETs, DNMTs, and 5-hydroxymethylcytosine. Roulois D, Deshayes S, Guilly MN, Nader JS, Liddell C, Robard M, Hulin P, Ouacher A, Le Martelot V, Fonteneau JF, Grégoire M, Blanquart C, Pouliquen DL. Oncotarget. 2016 June;7:34664-87. (Human)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/28/2022