LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
EIF5A Antibody LS‑C331828
EIF5A antibody LS-C331828 is an unconjugated rabbit polyclonal antibody to EIF5A from human, mouse and rat. Validated for IF, IHC and WB.
Catalog
Size
Price
LS-C331828-50
50 µl
$235
LS-C331828-100
100 µl
$315
LS-C331828-200
200 µl
$425

Popular EIF5A Products

Anti-EIF5A antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B4943 concentration 3.75 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Western blot of Human NCI-H226. EIF5A antibody dilution 1.0 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Mouse, Rat, Bovine, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken
Applications: Western blot
Immunofluorescence of monoclonal antibody to EIF5A on HeLa cell . [antibody concentration 10 ug/ml]
Species: Human
Applications: Immunofluorescence, Western blot, ELISA
Antibody
Species: Human
Applications: IHC, Immunofluorescence, Western blot, Flow Cytometry, ELISA

Product Description

EIF5A antibody LS-C331828 is an unconjugated rabbit polyclonal antibody to EIF5A from human, mouse and rat. Validated for IF, IHC and WB.
About EIF5A
mRNA-binding protein involved in translation elongation. Has an important function at the level of mRNA turnover, probably acting downstream of decapping. Involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. With syntenin SDCBP, functions as a regulator of p53/TP53 and p53/TP53-dependent apoptosis. Regulates also TNF-alpha-mediated apoptosis. P63241 NM_001970 NP_001961.1

EIF5A Antibody, EIF-4D Antibody, EIF-5A Antibody, EIF-5A-1 Antibody, EIF-5A1 Antibody, EIF5A1 Antibody, Initiation factor 5a Antibody, Rev-binding factor Antibody, EIF5AI Antibody


Specifications

Target
Human EIF5A
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
EIF5A antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human EIF5A (NP_001137234.1). MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK
Specificity
Human EIF5A
Usage
The predicted MW is 16kDa/20kDa, while the observed MW by Western blot was 17kDa.
Presentation
PBS with 0.02% sodium azide, 50% glycerol, pH 7.3
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney tissue.
Immunohistochemistry of paraffin-embedded human kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human liver using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human liver using EIF5A antibody at dilution of 1:200 (200x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney cancer using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human kidney cancer using EIF5A antibody at dilution of 1:200 (200x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human kidney using EIF5A antibody at dilution of 1:200 (200x lens).

Immunofluorescence

Immunofluorescence analysis of U2OS cells.
Immunofluorescence analysis of U2OS cells.

Immunofluorescence

Immunofluorescence analysis of U2OS cell using EIF5A antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cell using EIF5A antibody. Blue: DAPI for nuclear staining.

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Western blot

Western blot analysis of extracts of various cell lines, using EIF5A antibody.
Western blot analysis of extracts of various cell lines, using EIF5A antibody.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney tissue.
Immunohistochemistry of paraffin-embedded human kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human liver using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human liver using EIF5A antibody at dilution of 1:200 (200x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney cancer using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human kidney cancer using EIF5A antibody at dilution of 1:200 (200x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human kidney using EIF5A antibody at dilution of 1:200 (200x lens).

Immunofluorescence

Immunofluorescence analysis of U2OS cells.
Immunofluorescence analysis of U2OS cells.

Immunofluorescence

Immunofluorescence analysis of U2OS cell using EIF5A antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cell using EIF5A antibody. Blue: DAPI for nuclear staining.

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Western blot

Western blot analysis of extracts of various cell lines, using EIF5A antibody.
Western blot analysis of extracts of various cell lines, using EIF5A antibody.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney tissue.
Immunohistochemistry of paraffin-embedded human kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human liver using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human liver using EIF5A antibody at dilution of 1:200 (200x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney cancer using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human kidney cancer using EIF5A antibody at dilution of 1:200 (200x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human kidney using EIF5A antibody at dilution of 1:200 (200x lens).

Immunofluorescence

Immunofluorescence analysis of U2OS cells.
Immunofluorescence analysis of U2OS cells.

Immunofluorescence

Immunofluorescence analysis of U2OS cell using EIF5A antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cell using EIF5A antibody. Blue: DAPI for nuclear staining.

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Western blot

Western blot analysis of extracts of various cell lines, using EIF5A antibody.
Western blot analysis of extracts of various cell lines, using EIF5A antibody.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney tissue.
Immunohistochemistry of paraffin-embedded human kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human liver using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human liver using EIF5A antibody at dilution of 1:200 (200x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney cancer using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human kidney cancer using EIF5A antibody at dilution of 1:200 (200x lens).

Immunohistochemistry

Immunohistochemistry of paraffin-embedded human kidney using EIF5A antibody at dilution of 1:200 (200x lens).
Immunohistochemistry of paraffin-embedded human kidney using EIF5A antibody at dilution of 1:200 (200x lens).

Immunofluorescence

Immunofluorescence analysis of U2OS cells.
Immunofluorescence analysis of U2OS cells.

Immunofluorescence

Immunofluorescence analysis of U2OS cell using EIF5A antibody. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cell using EIF5A antibody. Blue: DAPI for nuclear staining.

Immunofluorescence

Immunofluorescence analysis of A549 cells.
Immunofluorescence analysis of A549 cells.

Western blot

Western blot analysis of extracts of various cell lines, using EIF5A antibody.
Western blot analysis of extracts of various cell lines, using EIF5A antibody.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 7/20/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number