Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C331391-20 20 µl $263 
LS-C331391-50 50 µl $301 
LS-C331391-100 100 µl $359 
LS-C331391-200 200 µl $473 
EIF4EBP1 / 4EBP1 Antibody - Western blot analysis of extracts of various cell lines, using EIF4EBP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
EIF4EBP1 / 4EBP1 Antibody - Western blot analysis of K562 cell lysate.
EIF4EBP1 / 4EBP1 Antibody - Western blot analysis of extracts of various cell lines, using EIF4EBP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
EIF4EBP1 / 4EBP1 Antibody - Western blot analysis of K562 cell lysate.
1 of 2
2 of 2

Polyclonal Rabbit anti‑Human EIF4EBP1 / 4EBP1 Antibody (IHC, WB) LS‑C331391

Polyclonal Rabbit anti‑Human EIF4EBP1 / 4EBP1 Antibody (IHC, WB) LS‑C331391

EIF4EBP1 / 4EBP1 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


EIF4EBP1 / 4EBP1 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


4EBP1 antibody LS-C331391 is an unconjugated rabbit polyclonal antibody to 4EBP1 (EIF4EBP1) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Human EIF4EBP1 / 4EBP1
EIF4EBP1 | 4E-BP1 | 4EBP1 | BP-1 | PHAS-I | EIF4E-binding protein 1
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human EIF4EBP1 (NP_004086.1). TRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Human EIF4EBP1 / 4EBP1
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
The predicted MW is 12kDa, while the observed MW by Western blot was 20kDa/22kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About EIF4EBP1 / 4EBP1
Q13541 NM_004095 NP_004086.1

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 11/28/2022