LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
EIF2S2 Antibody LS‑C334369
EIF2S2 antibody LS-C334369 is an unconjugated rabbit polyclonal antibody to EIF2S2 from human, mouse and rat. Validated for IHC and WB.
Catalog
Size
Price
LS-C334369-50
50 µl
$235
LS-C334369-100
100 µl
$295
LS-C334369-200
200 µl
$385

Popular EIF2S2 Products

Western blot of extracts from C2C12 cells untreated or treated with PMA using eIF2b (phospho-Ser2) antibody.
Species: Human, Mouse
Applications: Western blot
Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human, Mouse, Rat, Chicken, Xenopus, Zebrafish
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, Immunoprecipitation
IHC of paraffin-embedded Colon ca, using EIF2 beta antibody at 1:500 dilution.
Species: Human
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
Immunoperoxidase of monoclonal antibody to EIF2S2 on formalin-fixed paraffin-embedded human pancreatic cancer. [antibody concentration 3 ug/ml]
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Human Breast: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human, Monkey, Mouse
Applications: IHC, IHC - Paraffin, Western blot

Product Description

EIF2S2 antibody LS-C334369 is an unconjugated rabbit polyclonal antibody to EIF2S2 from human, mouse and rat. Validated for IHC and WB.

Specifications

Target
Human EIF2S2
Synonyms
EIF2S2, EIF-2-beta, EIF2, EIF2B, EIF2beta, PPP1R67
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
EIF2S2 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 134-333 of human EIF2S2 (NP_003899.2). PDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
Specificity
Human EIF2S2
Usage
The predicted MW is 38kDa, while the observed MW by Western blot was 47kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About EIF2S2
eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. P20042 NM_003908 NP_003899.2


Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 11/12/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy