Menu
Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Research Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C346393-50 50 µl $235 
LS-C346393-100 100 µl $315 
LS-C346393-200 200 µl $425 
EBS / NAT9 Antibody - Immunofluorescence analysis of MCF7 cells.

EBS / NAT9 Antibody LS‑C346393

EBS / NAT9 Antibody LS‑C346393

Antibody:
Rabbit Polyclonal to Human EBS / NAT9
Application:
IHC, IF, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$235 
LS-C346393-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human EBS / NAT9
Application:
IHC, IF, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
NAT9 antibody LS-C346393 is an unconjugated rabbit polyclonal antibody to human NAT9 (EBS ). Validated for IF, IHC and WB.
Target
Human EBS / NAT9
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-207 of human NAT9 (NP_056469.2). MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFIVLDAEKWQAQPGATEESCMVGDVNLFLTDLEDLTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGVTTLGLTKFEAKIGQGNEPSIRMFQKLHFEQVATSSVFQEVTLRLTVSESEHQWLLEQTSHVEEKPYRDGSAEPC
Specificity
Human EBS / NAT9
Usage
The predicted MW is 23kDa, while the observed MW by Western blot was Refer to Figures.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About EBS / NAT9
Q9BTE0 NM_015654 NP_056469.2

Publications (0)

Reviews (0)

Featured Products

EBS / NAT9 Antibody - NAT9 antibody Western blot of Fetal Brain lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Guinea pig, Pig
Applications: Western blot
EBS / NAT9 Antibody - EBS / NAT9 antibody Western Blot of Fetal Spleen. Antibody dilution: 1 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: Western blot
EBS / NAT9 Antibody - NAT9 antibody Western blot of Fetal Brain lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Chimpanzee, Gibbon, Monkey, Guinea pig, Pig
Applications: Western blot
EBS / NAT9 Antibody - NAT9 antibody Western blot of Fetal Brain lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Chimpanzee, Gibbon, Monkey, Guinea pig, Pig
Applications: Western blot

Requested From: United States
Date Requested: 10/17/2019