Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C748908-20 20 µl $253 
LS-C748908-50 50 µl (1.04 mg/ml) $279 
LS-C748908-100 100 µl $333 
LS-C748908-200 200 µl $429 
DYNLL2 Antibody - Western blot analysis of extracts of various cell lines, using DYNLL2 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5min.

Polyclonal Rabbit anti‑Human DYNLL2 Antibody (WB) LS‑C748908

Polyclonal Rabbit anti‑Human DYNLL2 Antibody (WB) LS‑C748908

Antibody:
DYNLL2 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$253
LS-C748908-20
Toll Free North America
866-819-4732
For Research Use Only

Overview

Antibody:
DYNLL2 Rabbit anti-Human Polyclonal Antibody
Application:
WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
DYNLL2 antibody LS-C748908 is an unconjugated rabbit polyclonal antibody to DYNLL2 from human. It is reactive with human, mouse and rat. Validated for WB.
Target
Human DYNLL2
Synonyms
DYNLL2 | 8 kDa dynein light chain b | Dynein light chain LC8-type 2 | DLC8b | DNCL1B | DLC2 | RSPH22 | Radial spoke 22 homolog
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-89 of human DYNLL2 (NP_542408.1). MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Applications
  • Western blot (1:500 - 1:2000)
Usage
The predicted MW is 10kDa, while the observed MW by Western blot was 12kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About DYNLL2
Q96FJ2 NP_542408.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 1/22/2022