Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

DHCR7 Antibody

DHCR7 antibody LS-C409588 is an unconjugated rabbit polyclonal antibody to human DHCR7. Validated for IF, IHC and WB.
50 µl
100 µl
200 µl
DHCR7 antibody LS-C409588 is an unconjugated rabbit polyclonal antibody to human DHCR7. Validated for IF, IHC and WB.
Human DHCR7
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
DHCR7 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 346-475 of human DHCR7 (NP_001351.2). VGYYIFRVANHQKDLFRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMGSLAYCLACGGGHLLPYFYIIYMAILLTHRCLRDEHRCASKYGRDWERYTAAVPYRLLPGIF
Human DHCR7
The predicted MW is 54kDa, while the observed MW by Western blot was 70kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About DHCR7
Q9UBM7 NM_001360 NP_001351.2

Popular DHCR7 Products

DHCR7 Antibody immunohistochemistry of formalin-fixed and paraffin-embedded human testis tissue followed by peroxidase-conjugated secondary antibody and DAB staining.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
Species: Mouse
Applications: IHC, ICC, Immunofluorescence, Western blot, ELISA
Species: Mouse
Applications: IHC, ICC, Immunofluorescence, Western blot, ELISA
Species: Mouse
Applications: IHC, ICC, Immunofluorescence, Western blot, ELISA
Species: Mouse
Applications: IHC, ICC, Immunofluorescence, Western blot, ELISA

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Requested From: United States
Date Requested: 1/23/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy