Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

CXCL10 / IP-10 Antibody LS-C335160

IP-10 antibody LS-C335160 is an unconjugated rabbit polyclonal antibody to human IP-10 (CXCL10). Validated for IHC and WB.
50 µl
100 µl
200 µl
IP-10 antibody LS-C335160 is an unconjugated rabbit polyclonal antibody to human IP-10 (CXCL10). Validated for IHC and WB.
Human CXCL10 / IP-10
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
CXCL10 / IP-10 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 20-98 of human CXCL10 (NP_001556.2). QGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Human CXCL10 / IP-10
The predicted MW is 10kDa, while the observed MW by Western blot was 11kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About CXCL10 / IP-10
P02778 NM_001565 NP_001556.2

Popular CXCL10 / IP-10 Products

Western Blot (reducing) of IP-10 / CXCL10 antibody. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse
Applications: Western blot, ELISA
Western Blot (reducing) of IP-10 / CXCL10 antibody. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: Western blot, ELISA
Western Blot (reducing) of IP-10 / CXCL10 antibody. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Rat
Applications: Western blot, ELISA
Species: Human
Applications: Western blot, ELISA
Human Lung: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of HeLa cells, using CXCL10 antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
Western blot analysis of extracts of HeLa cells, using CXCL10 antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.

Western blot

Western blot analysis of extracts of HeLa cells, using CXCL10 antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
Western blot analysis of extracts of HeLa cells, using CXCL10 antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.

Western blot

Western blot analysis of extracts of HeLa cells, using CXCL10 antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
Western blot analysis of extracts of HeLa cells, using CXCL10 antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.

Western blot

Western blot analysis of extracts of HeLa cells, using CXCL10 antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
Western blot analysis of extracts of HeLa cells, using CXCL10 antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.

Requested From: United States
Date Requested: 3/20/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy