LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
CSRP1 Antibody LS‑C335121
CSRP1 antibody LS-C335121 is an unconjugated rabbit polyclonal antibody to CSRP1 from human and mouse. Validated for IF, IHC, IP, RnaIP and WB.
Catalog
Size
Price
LS-C335121-50
50 µl
$235
LS-C335121-100
100 µl
$315
LS-C335121-200
200 µl
$425

Popular CSRP1 Products

Anti-CRP1 / CSRP1 antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B8405 dilution 5 ug/ml.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Antibody
Species: Human, Mouse, Rat
Applications: IHC, ICC, Western blot, Immunoprecipitation
Immunohistochemical analysis of CSRP1 staining in human brain formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
Species: Human, Mouse, Rat, Chicken
Applications: IHC, IHC - Paraffin, Western blot, Immunoprecipitation
Immunofluorescence of monoclonal antibody to CSRP1 on HeLa cell . [antibody concentration 10 ug/ml]
Species: Human
Applications: Immunofluorescence, Western blot, ELISA

Product Description

CSRP1 antibody LS-C335121 is an unconjugated rabbit polyclonal antibody to CSRP1 from human and mouse. Validated for IF, IHC, IP, RnaIP and WB.
About CSRP1
CRP1 / CSRP1 is a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. P21291 NM_004078 NP_004069.1

CSRP1 Antibody, CSRP Antibody, CYRP Antibody, Cysteine-rich protein 1 Antibody, D1S181E Antibody, CRP1 Antibody, LIM-domain protein Antibody


Specifications

Target
Human CSRP1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:50 - 1:200)
  • RNA Immunoprecipitation (1:20 - 1:50)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
CSRP1 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP1 (NP_004069.1). MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
Specificity
Human CRP1 / CSRP1
Usage
The predicted MW is 20kDa, while the observed MW by Western blot was 21kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Western blot

Western blot analysis of extracts of various cell lines, using CSRP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
Western blot analysis of extracts of various cell lines, using CSRP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.

Western blot

Western blot analysis of various cell lines.
Western blot analysis of various cell lines.

Immunoprecipitation

Immunoprecipitation analysis of 200ug extracts of HepG2 cells using 1ug CSRP1 antibody. Western blot was performed from the immunoprecipitate using CSRP1 antibodyat a dilition of 1:1000.
Immunoprecipitation analysis of 200ug extracts of HepG2 cells using 1ug CSRP1 antibody. Western blot was performed from the immunoprecipitate using CSRP1 antibodyat a dilition of 1:1000.

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Western blot

Western blot analysis of extracts of various cell lines, using CSRP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
Western blot analysis of extracts of various cell lines, using CSRP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.

Western blot

Western blot analysis of various cell lines.
Western blot analysis of various cell lines.

Immunoprecipitation

Immunoprecipitation analysis of 200ug extracts of HepG2 cells using 1ug CSRP1 antibody. Western blot was performed from the immunoprecipitate using CSRP1 antibodyat a dilition of 1:1000.
Immunoprecipitation analysis of 200ug extracts of HepG2 cells using 1ug CSRP1 antibody. Western blot was performed from the immunoprecipitate using CSRP1 antibodyat a dilition of 1:1000.

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Western blot

Western blot analysis of extracts of various cell lines, using CSRP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
Western blot analysis of extracts of various cell lines, using CSRP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.

Western blot

Western blot analysis of various cell lines.
Western blot analysis of various cell lines.

Immunoprecipitation

Immunoprecipitation analysis of 200ug extracts of HepG2 cells using 1ug CSRP1 antibody. Western blot was performed from the immunoprecipitate using CSRP1 antibodyat a dilition of 1:1000.
Immunoprecipitation analysis of 200ug extracts of HepG2 cells using 1ug CSRP1 antibody. Western blot was performed from the immunoprecipitate using CSRP1 antibodyat a dilition of 1:1000.

Immunofluorescence

Immunofluorescence analysis of HeLa cells.
Immunofluorescence analysis of HeLa cells.

Western blot

Western blot analysis of extracts of various cell lines, using CSRP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
Western blot analysis of extracts of various cell lines, using CSRP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.

Western blot

Western blot analysis of various cell lines.
Western blot analysis of various cell lines.

Immunoprecipitation

Immunoprecipitation analysis of 200ug extracts of HepG2 cells using 1ug CSRP1 antibody. Western blot was performed from the immunoprecipitate using CSRP1 antibodyat a dilition of 1:1000.
Immunoprecipitation analysis of 200ug extracts of HepG2 cells using 1ug CSRP1 antibody. Western blot was performed from the immunoprecipitate using CSRP1 antibodyat a dilition of 1:1000.

Requested From: United States
Date Requested: 8/19/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy