Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C331506-20 20 µl $263 
LS-C331506-50 50 µl $301 
LS-C331506-100 100 µl $359 
LS-C331506-200 200 µl $473 
CRD-BP / ZBP1 / IGF2BP1 Antibody - Immunohistochemistry of paraffin-embedded human stomach using IGF2BP1 antibodyat dilution of 1:100 (40x lens).
CRD-BP / ZBP1 / IGF2BP1 Antibody - Immunohistochemistry of paraffin-embedded human esophageal cancer using IGF2BP1 antibody at dilution of 1:100 (400x lens).
CRD-BP / ZBP1 / IGF2BP1 Antibody - Immunofluorescence analysis of U2OS cells using IGF2BP1 antibodyat dilution of 1:100. Blue: DAPI for nuclear staining.
CRD-BP / ZBP1 / IGF2BP1 Antibody - Western blot analysis of extracts of various cell lines, using IGF2BP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
CRD-BP / ZBP1 / IGF2BP1 Antibody - Western blot analysis of extracts of various cell lines, using IGF2BP1 antibody.
CRD-BP / ZBP1 / IGF2BP1 Antibody - Immunoprecipitation analysis of 200ug extracts of K562 cells.
CRD-BP / ZBP1 / IGF2BP1 Antibody - Immunohistochemistry of paraffin-embedded human stomach using IGF2BP1 antibodyat dilution of 1:100 (40x lens).
CRD-BP / ZBP1 / IGF2BP1 Antibody - Immunohistochemistry of paraffin-embedded human esophageal cancer using IGF2BP1 antibody at dilution of 1:100 (400x lens).
CRD-BP / ZBP1 / IGF2BP1 Antibody - Immunofluorescence analysis of U2OS cells using IGF2BP1 antibodyat dilution of 1:100. Blue: DAPI for nuclear staining.
CRD-BP / ZBP1 / IGF2BP1 Antibody - Western blot analysis of extracts of various cell lines, using IGF2BP1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
CRD-BP / ZBP1 / IGF2BP1 Antibody - Western blot analysis of extracts of various cell lines, using IGF2BP1 antibody.
CRD-BP / ZBP1 / IGF2BP1 Antibody - Immunoprecipitation analysis of 200ug extracts of K562 cells.
1 of 6
2 of 6
3 of 6
4 of 6
5 of 6
6 of 6

Polyclonal Rabbit anti‑Human CRD‑BP / ZBP1 / IGF2BP1 Antibody (IHC, IF, WB) LS‑C331506

Polyclonal Rabbit anti‑Human CRD‑BP / ZBP1 / IGF2BP1 Antibody (IHC, IF, WB) LS‑C331506

CRD-BP / ZBP1 / IGF2BP1 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


CRD-BP / ZBP1 / IGF2BP1 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


IGF2BP1 antibody LS-C331506 is an unconjugated rabbit polyclonal antibody to IGF2BP1 (CRD-BP / ZBP1) from human. It is reactive with human, mouse and rat. Validated for IF, IHC, IP and WB.
Human CRD-BP / ZBP1 / IGF2BP1
IGF2BP1 | CRD-BP | CRDBP | IMP1 | IGF2 mRNA-binding protein 1 | IMP-1 | ZBP-1 | Zip code-binding protein 1 | Zipcode-binding protein 1 | VICKZ family member 1 | IGF-II mRNA-binding protein 1 | VICKZ1
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
A synthetic peptide corresponding to a sequence within amino acids 500 to the C-Terminus of human IGF2BP1 (NP_006537.3). GRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
Human CRD-BP / ZBP1 / IGF2BP1
  • IHC (1:50 - 1:100)
  • Immunofluorescence
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:50 - 1:200)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
The predicted MW is 48kDa/63kDa, while the observed MW by Western blot was 71kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CRD-BP / ZBP1 / IGF2BP1
Q9NZI8 NM_006546 NP_006537.3

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 12/6/2022