LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

COL4A5 / Collagen IV Alpha5 Antibody for IHC, WB/Western IHC-plus™ LS-B15572

Note: This antibody replaces LS-C411336
Collagen IV Alpha5 antibody LS-B15572 is an unconjugated rabbit polyclonal antibody to human Collagen IV Alpha5 (COL4A5). Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Catalog
Size
Price
LS-B15572-50
50 µl
$425
Description
Collagen IV Alpha5 antibody LS-B15572 is an unconjugated rabbit polyclonal antibody to human Collagen IV Alpha5 (COL4A5). Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Target
Human COL4A5 / Collagen IV Alpha5
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1462-1691 of human COL4A5 (NP_203699.1). SSVAHGFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISRCQVCMKRT
Specificity
Human COL4A5 / Collagen IV Alpha5
Usage
The predicted MW is 161kDa, while the observed MW by Western blot was 161kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About COL4A5 / Collagen IV Alpha5
P29400 NM_000495 NP_000486.1

Popular COL4A5 / Collagen IV Alpha5 Products

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue, using Collagen IV alpha5 Antibody. The picture on the right is blocked with the synthesized peptide.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Immunofluorescence, Peptide Enzyme-Linked Immunosorbent Assay
Antibody
Species: Human
Applications: IHC, Western blot, ELISA
Western blot of recombinant COL4A5 / Collagen IV.
Species: Human
Applications: Western blot
Antibody
Species: Human
Applications: IHC, Western blot

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry - Paraffin

Human Breast, Fibrous Tissue: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Breast, Fibrous Tissue: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Immunohistochemistry - Paraffin

Human Breast, Fibrous Tissue: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Breast, Fibrous Tissue: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Immunohistochemistry - Paraffin

Human Breast, Fibrous Tissue: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Breast, Fibrous Tissue: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Immunohistochemistry - Paraffin

Human Breast, Fibrous Tissue: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Breast, Fibrous Tissue: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Requested From: United States
Date Requested: 1/19/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy