LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
COG2 Antibody LS‑C334587
COG2 antibody LS-C334587 is an unconjugated rabbit polyclonal antibody to COG2 from human, mouse and rat. Validated for IHC and WB.
Catalog
Size
Price
LS-C334587-50
50 µl
$235
LS-C334587-100
100 µl
$315
LS-C334587-200
200 µl
$425

Popular COG2 Products

COG2 Antibody (RB17913) IHC of formalin-fixed and paraffin-embedded human Lung carcinoma followed by peroxidase-conjugated secondary antibody and DAB staining.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
Antibody
Species: Human
Applications: IHC, Western blot, Flow Cytometry, ELISA
Antibody
Species: Human
Applications: IHC, Western blot, Flow Cytometry, ELISA
Antibody
Species: Human
Applications: IHC, Western blot, Flow Cytometry, ELISA
Antibody
Species: Human
Applications: IHC, Western blot, Flow Cytometry, ELISA

Product Description

COG2 antibody LS-C334587 is an unconjugated rabbit polyclonal antibody to COG2 from human, mouse and rat. Validated for IHC and WB.
About COG2
COG2 is a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi complex. The encoded protein specifically interacts with the USO1 vesicle docking protein and may be necessary for normal Golgi ribbon formation and trafficking of Golgi enzymes. Mutations of this gene are associated with abnormal glycosylation within the Golgi apparatus. Alternative splicing results in multiple transcript variants. Q14746 NM_007357 NP_031383.1

COG2 Antibody, COG complex subunit 2 Antibody, LDLC Antibody


Specifications

Target
Human COG2
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
COG2 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human COG2 (NP_031383.1). MEKSRMNLPKGPDTLCFDKDEFMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVEKIEKILNSQSSKETSALEASSPLLTGQILERIATEFNQLQFHAVQSKGMPLLDKVRPRIAGITAMLQQSLEGLLLEGLQTSDVDIIRHCLRTYATIDKTRDAEALVGQVLVKPYIDEVIIEQFVESHPNGLQVMYNKLL
Specificity
Human COG2
Usage
The predicted MW is 83kDa, while the observed MW by Western blot was 88kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse kidney tissue.
Immunohistochemistry of paraffin-embedded mouse kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse kidney tissue.
Immunohistochemistry of paraffin-embedded mouse kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse kidney tissue.
Immunohistochemistry of paraffin-embedded mouse kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded mouse kidney tissue.
Immunohistochemistry of paraffin-embedded mouse kidney tissue.

Immunohistochemistry

Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 9/22/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy