LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
CNGA3 Antibody (aa1‑165) IHC‑plus™ LS‑B13903
Note: This antibody replaces LS-C335319
CNGA3 antibody LS-B13903 is an unconjugated rabbit polyclonal antibody to CNGA3 from human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Catalog
Size
Price
LS-B13903-50
50 µl
$425

Popular CNGA3 Products

Western blot analysis of Mouse kidney and brain tissue, using CNGA3 Polyclonal Antibody at dilution of 1:500.
Species: Human, Mouse
Applications: Western blot, ELISA
Western blot analysis of Mouse kidney and brain tissue, using CNGA3 Polyclonal Antibody at dilution of 1:500.
Species: Human, Mouse
Applications: Western blot, ELISA
Antibody
Species: Human
Applications: Western blot, ELISA
Immunohistochemistry of paraffin-embedded Human rectal tissue at dilution 1:100
Species: Human
Applications: IHC, ELISA

Product Description

CNGA3 antibody LS-B13903 is an unconjugated rabbit polyclonal antibody to CNGA3 from human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
About CNGA3
Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cyclic GMP which leads to an opening of the cation channel and thereby causing a depolarization of cone photoreceptors. Q16281 NM_001298 NP_001289.1

CNGA3 Antibody, CCNCa Antibody, CCNCalpha Antibody, CCNC1 Antibody, CNG channel alpha-3 Antibody, CNG3 Antibody, ACHM2 Antibody, Achromatopsia 2 Antibody, MCNG3 Antibody, CNCG3 Antibody, CNG-3 Antibody


Specifications

Target
Human CNGA3
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (1:100)
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
CNGA3 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CNGA3 (NP_001289.1). MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADSGQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSS
Epitope
aa1-165
Specificity
Human CNGA3
Usage
The predicted MW is 76-79kDa, while the observed MW by Western blot was 110kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry - Paraffin

Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of HEK-293 extracts, using CNGA3 antibody.
Western blot analysis of HEK-293 extracts, using CNGA3 antibody.

Immunohistochemistry - Paraffin

Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of HEK-293 extracts, using CNGA3 antibody.
Western blot analysis of HEK-293 extracts, using CNGA3 antibody.

Immunohistochemistry - Paraffin

Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of HEK-293 extracts, using CNGA3 antibody.
Western blot analysis of HEK-293 extracts, using CNGA3 antibody.

Immunohistochemistry - Paraffin

Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)

Western blot

Western blot analysis of HEK-293 extracts, using CNGA3 antibody.
Western blot analysis of HEK-293 extracts, using CNGA3 antibody.

Requested From: United States
Date Requested: 8/15/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number