LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

CNGA3 Antibody (aa1-165) IHC-plus™ LS-B13903

Note: This antibody replaces LS-C335319
Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)
Western blot analysis of HEK-293 extracts, using CNGA3 antibody.
Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)
Western blot analysis of HEK-293 extracts, using CNGA3 antibody.
1 of 2
2 of 2

CNGA3 Antibody (aa1-165) IHC-plus™ LS-B13903

Note: This antibody replaces LS-C335319
Antibody:
Rabbit Polyclonal to Human CNGA3
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$425 
LS-B13903-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human CNGA3
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
CNGA3 antibody LS-B13903 is an unconjugated rabbit polyclonal antibody to CNGA3 from human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.

Target
Human CNGA3
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin (1:100)
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
CNGA3 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human CNGA3 (NP_001289.1). MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADSGQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQANVGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSS
Epitope
aa1-165
Specificity
Human CNGA3
Usage
The predicted MW is 76-79kDa, while the observed MW by Western blot was 110kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CNGA3
Q16281 NM_001298 NP_001289.1

Validation

Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Validated
Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)
Human Brain, Cerebellum: Formalin-Fixed, Paraffin-Embedded (FFPE)

Publications (0)

Reviews (0)

Featured Products

Reactivity: Monkey
Range: 40-2000 pg/ml
Anti-Smooth Muscle Actin antibody IHC of human kidney, vessel. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 2.5 ug/ml.
Species: Human, Baboon, Mouse, Rat, Bovine, Rabbit, Chicken
Applications: IHC, IHC - Paraffin

Requested From: United States
Date Requested: 7/15/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy