LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
CLCNKA Antibody LS‑C332792
CLCNKA antibody LS-C332792 is an unconjugated rabbit polyclonal antibody to CLCNKA from human and mouse. Validated for IHC, IP and WB.
Catalog
Size
Price
LS-C332792-50
50 µl
$235
LS-C332792-100
100 µl
$295
LS-C332792-200
200 µl
$385

Popular CLCNKA Products

Antibody
Species: Human
Applications: IHC, Western blot, Immunoprecipitation, ELISA
Western blot of CLC-KA antibody
Species: Human
Applications: Western blot, ELISA
Antibody
Species: Human
Applications: Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Western blot analysis of the lysates from HepG2 cells using CLCNKA antibody.
Species: Human
Applications: Western blot, Peptide Enzyme-Linked Immunosorbent Assay

Product Description

CLCNKA antibody LS-C332792 is an unconjugated rabbit polyclonal antibody to CLCNKA from human and mouse. Validated for IHC, IP and WB.

Specifications

Target
Human CLCNKA
Synonyms
CLCNKA, Chloride channel, kidney, A, Clcnk1, ClC-K1, CLCK1, HClC-Ka, Chloride channel Ka
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:20 - 1:50)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
CLCNKA antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 470-644 of human CLCNKA (NP_001244068.1). QSCQPSFYDGTIIVKKLPYLPRILGRNIGSHHVRVEHFMNHSITTLAKDTPLEEVVKVVTSTDVTEYPLVESTESQILVGIVQRAQLVQALQAEPPSRAPGHQQCLQDILARGCPTEPVTLTLFSETTLHQAQNLFKLLNLQSLFVTSRGRAVGCVSWVEMKKAISNLTNPPAPK
Specificity
Human CLCNKA
Usage
The predicted MW is 70kDa/75kDa, while the observed MW by Western blot was 75kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About CLCNKA
CLCNKA is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functional channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene. P51800 NM_004070 NP_004061.3


Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of 293 cell line, using CLCNKA antibody.
Western blot analysis of extracts of 293 cell line, using CLCNKA antibody.

Western blot

Western blot analysis of extracts of 293 cell line, using CLCNKA antibody.
Western blot analysis of extracts of 293 cell line, using CLCNKA antibody.

Western blot

Western blot analysis of extracts of 293 cell line, using CLCNKA antibody.
Western blot analysis of extracts of 293 cell line, using CLCNKA antibody.

Western blot

Western blot analysis of extracts of 293 cell line, using CLCNKA antibody.
Western blot analysis of extracts of 293 cell line, using CLCNKA antibody.

Requested From: United States
Date Requested: 10/23/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy