LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

CLCN1 / CLC-1 Antibody

CLC-1 antibody LS-C335599 is an unconjugated rabbit polyclonal antibody to CLC-1 (CLCN1) from human and mouse. Validated for IHC and WB.
Catalog
Size
Price
LS-C335599-50
50 µl
$235
LS-C335599-100
100 µl
$315
LS-C335599-200
200 µl
$425
Description
CLC-1 antibody LS-C335599 is an unconjugated rabbit polyclonal antibody to CLC-1 (CLCN1) from human and mouse. Validated for IHC and WB.
Target
Human CLCN1 / CLC-1
Host
Rabbit
Reactivity
Human, Mouse (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
CLCN1 / CLC-1 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 779-988 of human CLCN1 (NP_000074.2). ARPTKKKTTQDSTDLVDNMSPEEIEAWEQEQLSQPVCFDSCCIDQSPFQLVEQTTLHKTHTLFSLLGLHLAYVTSMGKLRGVLALEELQKAIEGHTKSGVQLRPPLASFRNTTSTRKSTGAPPSSAENWNLPEDRPGATGTGDVIAASPETPVPSPSPEPPLSLAPGKVEGELEELELVESPGLEEELADILQGPSLRSTDEEDEDELIL
Specificity
Human CLCN1 / CLC-1
Usage
The predicted MW is 108kDa, while the observed MW by Western blot was 115kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
About CLCN1 / CLC-1
P35523 NM_000083 NP_000074.2

Popular CLCN1 / CLC-1 Products

Antibody
Species: Rat
Applications: Western blot, ELISA
All lanes: Anti-CLCN1 Antibody (N-Term) at 1:2000 dilution Lane 1: Human skeletal muslce lysate Lane 2: Mouse skeletal muscle lysate Lysates/proteins at 20 µg per lane. Secondary Goat Anti-Rabbit IgG, (H+L), Peroxidase conjugated at 1/10000 dilution. Predicted band size: 109 kDa Blocking/Dilution buffer: 5% NFDM/TBST.
Species: Human, Mouse
Applications: Western blot, Flow Cytometry, ELISA
Immunofluorescent analysis of HepG2 cells diluted at 1:100 and Alexa Fluor 488-congugated AffiniPure Goat Anti-Rabbit IgG(H+L)
Species: Human
Applications: Immunofluorescence, ELISA
Antibody
Species: Human
Applications: IHC, Western blot

Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 1/22/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy