Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

CHERP Antibody LS-C411236

CHERP antibody LS-C411236 is an unconjugated rabbit polyclonal antibody to CHERP from human and mouse. Validated for IHC and WB.
50 µl
100 µl
200 µl
CHERP antibody LS-C411236 is an unconjugated rabbit polyclonal antibody to CHERP from human and mouse. Validated for IHC and WB.
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:20 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
CHERP antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 650-750 of human CHERP (NP_006378.3). LPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSS
The predicted MW is 103kDa, while the observed MW by Western blot was 140kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
Q8IWX8 NM_006387 NP_006378.3

Popular CHERP Products

Species: Human
Applications: IHC, Western blot, ELISA
Species: Human
Applications: Western blot, ELISA
Species: Human
Applications: Western blot, ELISA
Detection of human CHERP by western blot. Samples: Whole cell lysate (50 µg) from HeLa, HEK293T, and Jurkat cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-CHERP antibody used for WB at 0.1 µg/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Species: Human
Applications: Western blot, Immunoprecipitation

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 5/20/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy