Products
Services
Research Areas
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Services
Immunohistochemistry Services

Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

TCR Screening Services

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

Reasearch Areas
Cell Cycle Pathways
Protein Family And Group
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
866-819-4732 (Toll Free North America
206-374-1102 (International)
Fax:
866-206-6909 (Toll Free North America)
206-577-4565 (International)
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, froforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order

CHAF1B / CAF1 Antibody LS‑C335645

Catalog Number Size Price
LS-C335645-50 50 µl $235 
LS-C335645-100 100 µl $315 
LS-C335645-200 200 µl $425 
Immunohistochemistry of paraffin-embedded mouse spleen tissue.
Immunohistochemistry of paraffin-embedded rat fallopian tube tissue.
Immunohistochemistry of paraffin-embedded human tonsil tissue.
Immunohistochemistry of paraffin-embedded rat spleen tissue.
Immunohistochemistry of paraffin-embedded mouse kidney tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunofluorescence analysis of MCF-7 cells.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded mouse spleen tissue.
Immunohistochemistry of paraffin-embedded rat fallopian tube tissue.
Immunohistochemistry of paraffin-embedded human tonsil tissue.
Immunohistochemistry of paraffin-embedded rat spleen tissue.
Immunohistochemistry of paraffin-embedded mouse kidney tissue.
Immunohistochemistry of paraffin-embedded rat brain tissue.
Immunofluorescence analysis of MCF-7 cells.
Western blot analysis of extracts of various cell lines.
1 of 8
2 of 8
3 of 8
4 of 8
5 of 8
6 of 8
7 of 8
8 of 8

CHAF1B / CAF1 Antibody LS‑C335645

Antibody:
Rabbit Polyclonal to Human CHAF1B / CAF1
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$235 
LS-C335645-50
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human CHAF1B / CAF1
Application:
IHC, IF, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
CAF1 antibody LS-C335645 is an unconjugated rabbit polyclonal antibody to CAF1 (CHAF1B ) from human, mouse and rat. Validated for IF, IHC and WB.
Target
Human CHAF1B / CAF1
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:20 - 1:100)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 270-559 of human CHAF1B (NP_005432.1). SRKNLKRPIAHLPCPGKATLAVRCCPVYFELRPVVETGVELMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLSDISWSSDGAFLAISSTDGYCSFVTFEKDELGIPLKEKPVLNMRTPDTAKKTKSQTHRGSSPGPRPVEGTPASRTQDPSSPGTTPPQARQAPAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP
Specificity
Human CHAF1B / CAF-1
Usage
The predicted MW is 61kDa, while the observed MW by Western blot was 70kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CHAF1B / CAF1
Q13112 NM_005441 NP_005432.1

Publications (0)

Reviews (0)

Featured Products

IHC of paraffin-embedded Human lymph node tissue using anti-CHAF1B mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120°C for 3min).
Species: Human, Monkey, Mouse, Rat, Dog
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot
Immunohistochemistry - Paraffin Image
Species: Human
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
Product
Species: Human, Mouse, Rat
Applications: IHC, Immunofluorescence, Western blot, ELISA
Product
Species: Human, Mouse, Rat
Applications: IHC, Immunofluorescence, Western blot
Reactivity: Mouse
Range: 0.156-10 ng/ml
Reactivity: Human
Range: 28.2-1800 pg/ml

Requested From: United States
Date Requested: 9/14/2019