Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
CELF2 / CUGBP2 Antibody LS‑C334461
CUGBP2 antibody LS-C334461 is an unconjugated rabbit polyclonal antibody to CUGBP2 (CELF2) from human, mouse and rat. Validated for WB.
50 µl
100 µl
200 µl

Popular CELF2 / CUGBP2 Products

CELF2 / CUGBP2 antibody ARP40323_T100-NP_006552-CUGBP2 (CUG triplet repeat, RNA binding protein 2) Antibody was used in IHC to stain formalin-fixed, paraffin-embedded human heart.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Rabbit, Chicken, Xenopus, Zebrafish
Applications: IHC, IHC - Paraffin, Western blot
Immunohistochemistry Dilution at 1:600 and staining in paraffin-embedded human tonsil tissue performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal Goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated Secondary antibody and visualized using an HRP conjugated SP system.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
Species: Human
Applications: IHC, Immunofluorescence, Western blot, Immunoprecipitation, ELISA
Anti-CELF2 / CUGBP2 antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Anti-CELF2 / CUGBP2 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Bovine
Applications: IHC, IHC - Paraffin, Western blot

Product Description

CUGBP2 antibody LS-C334461 is an unconjugated rabbit polyclonal antibody to CUGBP2 (CELF2) from human, mouse and rat. Validated for WB.


Human CELF2 / CUGBP2
CELF2, BRUNOL3, CELF-2, Bruno-like protein 3, CUG-BP2, CUGBP2, ETR-3, HNAPOR, NAPOR, RNA-binding protein BRUNOL-3, NAPOR-2, ETR3
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:200 - 1:500)
CELF2 / CUGBP2 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 422-521 of human CELF2 (NP_006552.3). QQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY
Human CELF2 / CUGBP2
The predicted MW is 52kDa/54kDa/55kDa, while the observed MW by Western blot was 60kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About CELF2 / CUGBP2
RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of TNNT2 in embryonic, but not adult, skeletal muscle. Activates TNNT2 exon 5 inclusion by antagonizing the repressive effect of PTB. O95319 NM_006561 NP_006552.3

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Requested From: United States
Date Requested: 11/12/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy