Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331529-20 20 µl (0.96 mg/ml) $287 
LS-C331529-50 50 µl $329 
LS-C331529-100 100 µl $407 
LS-C331529-200 200 µl $509 
CDK6 Antibody - Immunohistochemistry of paraffin-embedded mouse liver using CDK6 antibodyat dilution of 1:100 (40x lens).
CDK6 Antibody - Immunohistochemistry of paraffin-embedded mouse brain using CDK6 antibodyat dilution of 1:100 (40x lens).
CDK6 Antibody - Immunohistochemistry of paraffin-embedded human breast cancer using CDK6 antibodyat dilution of 1:100 (40x lens).
CDK6 Antibody - Immunohistochemistry of paraffin-embedded rat liver using CDK6 antibodyat dilution of 1:100 (40x lens).
CDK6 Antibody - Immunohistochemistry of paraffin-embedded human colon carcinoma using CDK6 antibodyat dilution of 1:100 (40x lens).
CDK6 Antibody - Immunofluorescence analysis of MCF-7 cells using CDK6 antibody. Blue: DAPI for nuclear staining.
CDK6 Antibody - Western blot analysis of extracts from normal (control) and CDK6 knockout (KO) HeLa cells, using CDK6 antibodyat 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.
CDK6 Antibody - Western blot analysis of extracts of various cell lines, using CDK6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
CDK6 Antibody - Immunoprecipitation analysis of 200ug extracts of Jurkat cells, using 3 ug CDK6 antibody. Western blot was performed from the immunoprecipitate using CDK6 antibodyat a dilition of 1:1000.
CDK6 Antibody - Immunohistochemistry of paraffin-embedded mouse liver using CDK6 antibodyat dilution of 1:100 (40x lens).
CDK6 Antibody - Immunohistochemistry of paraffin-embedded mouse brain using CDK6 antibodyat dilution of 1:100 (40x lens).
CDK6 Antibody - Immunohistochemistry of paraffin-embedded human breast cancer using CDK6 antibodyat dilution of 1:100 (40x lens).
CDK6 Antibody - Immunohistochemistry of paraffin-embedded rat liver using CDK6 antibodyat dilution of 1:100 (40x lens).
CDK6 Antibody - Immunohistochemistry of paraffin-embedded human colon carcinoma using CDK6 antibodyat dilution of 1:100 (40x lens).
CDK6 Antibody - Immunofluorescence analysis of MCF-7 cells using CDK6 antibody. Blue: DAPI for nuclear staining.
CDK6 Antibody - Western blot analysis of extracts from normal (control) and CDK6 knockout (KO) HeLa cells, using CDK6 antibodyat 1:500 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.
CDK6 Antibody - Western blot analysis of extracts of various cell lines, using CDK6 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking.
CDK6 Antibody - Immunoprecipitation analysis of 200ug extracts of Jurkat cells, using 3 ug CDK6 antibody. Western blot was performed from the immunoprecipitate using CDK6 antibodyat a dilition of 1:1000.
1 of 9
2 of 9
3 of 9
4 of 9
5 of 9
6 of 9
7 of 9
8 of 9
9 of 9

Polyclonal Rabbit anti‑Human CDK6 Antibody (IHC, IF, WB) LS‑C331529

Polyclonal Rabbit anti‑Human CDK6 Antibody (IHC, IF, WB) LS‑C331529

Antibody:
CDK6 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$287
LS-C331529-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
CDK6 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF, WB, IP
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
CDK6 antibody LS-C331529 is an unconjugated rabbit polyclonal antibody to CDK6 from human. It is reactive with human, mouse and rat. Validated for IF, IHC, IP and WB.
Target
Human CDK6
Synonyms
CDK6 | CDKN6 | Cell division protein kinase 6 | Cyclin-dependent kinase 6 | Crk2 | PLSTIRE
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human CDK6 (NP_001250.1). MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Specificity
Human Cdk6
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 36kDa, while the observed MW by Western blot was 37kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CDK6
Q00534 NM_001259 NP_001250.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 11/27/2022