LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

CDC25C Antibody LS-C490522

CDC25C Antibody LS-C490522

Antibody:
Rabbit Polyclonal to Human CDC25C
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$435 
LS-C490522-100
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human CDC25C
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
CDC25C antibody LS-C490522 is an unconjugated rabbit polyclonal antibody to human CDC25C. Validated for WB.

Target
Human CDC25C
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Immunoaffinity purified
Modifications
Unmodified
Applications
  • Western blot (0.1 - 0.5 µg/ml)
Immunogen
CDC25C antibody was raised against amino acids MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP of human CDC25C were used as the immunogen for the CDC25C antibody.
Presentation
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitution
Reconstitute in sterile distilled water.
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CDC25C
P30307 NM_001790 NP_001781.2

Publications (0)

Reviews (0)

Featured Products

Flow cytometry of CD30 antibody This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: Flow Cytometry
HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY KRAS (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-KRAS.
Species: Human
Applications: Western blot
Reactivity: Human
Range: 0.156-10 ng/ml
Reactivity: Human
Range: 0.156-10 ng/ml

Requested From: United States
Date Requested: 6/26/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy