LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us

CDC25C Antibody (aa435-473) LS-C408061

Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53 kD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

CDC25C Antibody (aa435-473) LS-C408061

Antibody:
Rabbit Polyclonal to Human CDC25C
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$325 
LS-C408061-100
Toll Free North America
866-819-4732

Overview

Antibody:
Rabbit Polyclonal to Human CDC25C
Application:
WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
CDC25C antibody LS-C408061 is an unconjugated rabbit polyclonal antibody to human CDC25C. Validated for WB.

Target
Human CDC25C
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • Western blot (0.1 - 0.5 µg/ml)
Immunogen
CDC25C antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human Cdc25C (435-473aa MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP), different from the related mouse sequence by ten amino acids.
Epitope
aa435-473
Presentation
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitution
Reconstitute in 200 ul distilled water
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CDC25C
P30307 NM_001790 NP_001781.2

Publications (0)

Reviews (0)

Featured Products

Reactivity: Mouse
Range: 78.13-5000 pg/ml
Anti-DES / Desmin antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 3.75 ug/ml.
Species: Human, Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Chicken
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Reactivity: Human
Range: 37.5-2400 pg/ml
Anti-MSLN / Mesothelin antibody IHC staining of human tonsil. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 15 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA

Requested From: United States
Date Requested: 6/26/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy