Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
CDC25C Antibody (aa435‑473) LS‑C408061
CDC25C antibody LS-C408061 is an unconjugated rabbit polyclonal antibody to human CDC25C. Validated for WB.
100 µg

Popular CDC25C Products

Immunohistochemical analysis of CDC25C (pS216) staining in human lung cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP-conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
Immunofluorescence analysis of U2OS cells.
Species: Human
Applications: IHC, ICC, Immunofluorescence, Western blot, Immunoprecipitation
Anti-CDC25C antibody IHC of human testis. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B4149 dilution 1:200.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Immunohistochemical analysis of CDC25C staining in human breast cancer formalin fixed paraffin embedded tissue section. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0). The section was then incubated with the antibody at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with hematoxylin and mounted with DPX.
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, ICC, Immunofluorescence, Western blot
Immunoperoxidase of monoclonal antibody to CDC25C on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6 ug/ml]
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Immunoprecipitation, ELISA, RNA interference

Product Description

CDC25C antibody LS-C408061 is an unconjugated rabbit polyclonal antibody to human CDC25C. Validated for WB.
About CDC25C
CDC25C, a CDC25 dual specificity protein phosphatase, has been shown to affect the regulation of cell cycle control, and specifically the G2/M progression, through interaction with cdc/cyclin kinases and proliferating cell nuclear antigen (PCNA). Unlike CDC25A and CDC25B, CDC25C does not seem to have oncogenic properties. CDC25C null mutant mice are viable, fertile, and do not display obvious abnomalities. P30307 NM_001790 NP_001781.2

CDC25C Antibody, CDC25 Antibody, CDC25C phosphatase Antibody, CDC25Hu3 Antibody, Cell division cycle 25C Antibody, Phosphotyrosine phosphatase Antibody, PPP1R60 Antibody, M-phase inducer phosphatase 3 Antibody, Mitosis inducer CDC25 Antibody


Human CDC25C
Human (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • Western blot (0.1 - 0.5 µg/ml)
CDC25C antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human Cdc25C (435-473aa MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP), different from the related mouse sequence by ten amino acids.
Lyophilized from 7.1 mM sodium phosphate, 77 mM NaCl, 2.5% BSA, 0.025% sodium azide
Reconstitute with 200 µl of distilled water.
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53 kD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53 kD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

Western blot

Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53 kD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53 kD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

Western blot

Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53 kD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53 kD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

Western blot

Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53 kD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53 kD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.

Requested From: United States
Date Requested: 9/25/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy