Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

CD81 Antibody

CD81 antibody LS-C498010 is an unconjugated rabbit polyclonal antibody to mouse CD81. Validated for IHC and WB.
50 µl
100 µl
200 µl
CD81 antibody LS-C498010 is an unconjugated rabbit polyclonal antibody to mouse CD81. Validated for IHC and WB.
Human CD81
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • IHC (1:50 - 1:200)
  • Western blot (1:500 - 1:2000)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
CD81 antibody was raised against a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD81 (NP_004347.1). MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVI
The predicted MW is 25kDa, while the observed MW by Western blot was 23kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About CD81
P60033 NM_004356 NP_004347.1

Popular CD81 Products

Species: Human
Applications: ICC, Western blot, Flow Cytometry
Anti-CD81 antibody IHC of human tonsil, germinal center. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:50.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Flow Cytometry
Flow cytometry of CD81 antibody This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: ICC, Western blot, Flow Cytometry
Immunohistochemistry of CD81 in human brain tissue with CD81 antibody at 2 µg/ml.
Species: Human, Mouse, Rat
Applications: IHC, Immunofluorescence, Western blot, ELISA
Frozen human tonsil stained with peroxidase-conjugate and AEC chromogen. Note cell membrane staining of lymphocytes.
Species: Human
Applications: IHC, IHC - Frozen, Immunofluorescence, Flow Cytometry

Publications (0)

Customer Reviews (0)



Immunohistochemistry of paraffin-embedded mouse lung tissue.
Immunohistochemistry of paraffin-embedded mouse lung tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.


Immunohistochemistry of paraffin-embedded mouse lung tissue.
Immunohistochemistry of paraffin-embedded mouse lung tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.


Immunohistochemistry of paraffin-embedded mouse lung tissue.
Immunohistochemistry of paraffin-embedded mouse lung tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.


Immunohistochemistry of paraffin-embedded mouse lung tissue.
Immunohistochemistry of paraffin-embedded mouse lung tissue.

Western blot

Western blot analysis of extracts of various cell lines.
Western blot analysis of extracts of various cell lines.

Requested From: United States
Date Requested: 2/15/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy