Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
CD53 Antibody LS‑C496789
CD53 antibody LS-C496789 is an unconjugated rabbit polyclonal antibody to CD53 from human and mouse. Validated for WB.
50 µl
100 µl
200 µl

Popular CD53 Products

Species: Human
Applications: Flow Cytometry
Anti-CD53 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody LS-B4184 concentration 10 ug/ml.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human
Applications: IHC, IHC - Paraffin, IHC - Frozen, Western blot, Immunoprecipitation, Flow Cytometry
Species: Human
Applications: IHC - Frozen, Western blot, Immunoprecipitation, Flow Cytometry, Functional Assay
Species: Human
Applications: IHC, IHC - Frozen, Immunofluorescence, Flow Cytometry
Species: Human
Applications: IHC, IHC - Frozen, Western blot, Immunoprecipitation, Flow Cytometry

Product Description

CD53 antibody LS-C496789 is an unconjugated rabbit polyclonal antibody to CD53 from human and mouse. Validated for WB.
About CD53
CD53 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. P19397 NM_000560 NP_000551.1

CD53 Antibody, CD53 antigen Antibody, CD53 molecule Antibody, CD53 tetraspan antigen Antibody, Cell surface antigen Antibody, Leukocyte surface antigen CD53 Antibody, Transmembrane glycoprotein Antibody, Tetraspanin-25 Antibody, Tspan-25 Antibody, CD53 glycoprotein Antibody, Cell surface glycoprotein CD53 Antibody, MOX44 Antibody, TSPAN25 Antibody


Human CD53
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:1000 - 1:4000)
CD53 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human CD53 (NP_000551.1). AILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS
The predicted MW is 24kDa, while the observed MW by Western blot was 35kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cell lines, using CD53 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
Western blot analysis of extracts of various cell lines, using CD53 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.

Western blot

Western blot analysis of extracts of various cell lines, using CD53 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
Western blot analysis of extracts of various cell lines, using CD53 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.

Western blot

Western blot analysis of extracts of various cell lines, using CD53 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
Western blot analysis of extracts of various cell lines, using CD53 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.

Western blot

Western blot analysis of extracts of various cell lines, using CD53 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.
Western blot analysis of extracts of various cell lines, using CD53 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.

Requested From: United States
Date Requested: 9/25/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy