Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
CD37 Antibody LS‑C497399
CD37 antibody LS-C497399 is an unconjugated rabbit polyclonal antibody to human CD37. Validated for WB.
50 µl
100 µl
200 µl

Popular CD37 Products

Anti-CD37 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 1:200.
Species: Human
Applications: IHC, IHC - Paraffin, Immunofluorescence, ELISA
Species: Human
Applications: IHC, IHC - Paraffin, IHC - Frozen, Immunoprecipitation, ELISA
Species: Human
Applications: Western blot, Flow Cytometry, ELISA
Species: Human
Applications: IHC, IHC - Paraffin, IHC - Frozen, Flow Cytometry, ELISA
Species: Human
Applications: Flow Cytometry

Product Description

CD37 antibody LS-C497399 is an unconjugated rabbit polyclonal antibody to human CD37. Validated for WB.


Human CD37
CD37, CD37 antigen, CD37 molecule, Leukocyte surface antigen CD37, gp52-40, TSPAN26, Leukocyte antigen CD37, Tetraspanin-26, Tspan-26
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
CD37 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 112-241 of human CD37 (NP_001765.1). RAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN
The predicted MW is 22kDa/23kDa/31kDa, while the observed MW by Western blot was Refer to Figures.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About CD37
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. P11049 NM_001774 NP_001765.1

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 11/14/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy