LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
CD118 / LIF Receptor Alpha Antibody LS‑C490334
LIF Receptor Alpha antibody LS-C490334 is an unconjugated rabbit polyclonal antibody to human LIF Receptor Alpha (CD118). Validated for WB.
Catalog
Size
Price
LS-C490334-100
100 µg
$365

Popular CD118 / LIF Receptor Alpha Products

Western blot of recombinant CD118 / LIFR.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Rat
Applications: IHC, Western blot
Western blot of recombinant CD118 / LIFR.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse
Applications: IHC, Western blot
Human Colon, Submucosal Plexus: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin, Western blot
Antibody
Species: Human
Applications: IHC, IHC - Paraffin, ELISA
Antibody
Species: Human
Applications: IHC, IHC - Paraffin, ELISA

Product Description

LIF Receptor Alpha antibody LS-C490334 is an unconjugated rabbit polyclonal antibody to human LIF Receptor Alpha (CD118). Validated for WB.
About CD118 / LIF Receptor Alpha
CD118 / LIF Receptor Alpha is a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. P42702 NM_002310 NP_002301.1

LIFR Antibody, CD118 Antibody, CD118 antigen Antibody, LIF receptor Antibody, SJS2 Antibody, STWS Antibody, Sws Antibody, LIF-R Antibody


Specifications

Target
Human CD118 / LIF Receptor Alpha
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Immunoaffinity purified
Modifications
Unmodified
Applications
  • Western blot (0.1 - 0.5 µg/ml)
Immunogen
Amino acids EWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLE of human LIFR were used as the immunogen for the LIFR antibody.
Presentation
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitution
Sterile distilled water
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only.
Guarantee
This antibody carries the LSBio 100% Guarantee.

Publications (0)


Customer Reviews (0)


Images

Western blot

Western blot

Western blot

Western blot


Requested From: United States
Date Requested: 7/20/2018

Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy



Catalog Number