Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

CCR2 Antibody LS-C408572

CCR2 antibody LS-C408572 is an unconjugated rabbit polyclonal antibody to CCR2 from human and mouse. Validated for WB.
50 µl
100 µl
200 µl
CCR2 antibody LS-C408572 is an unconjugated rabbit polyclonal antibody to CCR2 from human and mouse. Validated for WB.
Human CCR2
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
CCR2 antibody was raised against recombinant fusion protein containing a sequence corresponding to amino acids 315-374 of human CCR2 (NP_001116513.2). LFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQDKEGA
Human CCR2
The predicted MW is 41kDa, while the observed MW by Western blot was 50kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About CCR2
P41597 NP_001116868.1

Popular CCR2 Products

Species: Mouse, Rat
Applications: Flow Cytometry
Human Tonsil: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human
Applications: IHC, IHC - Paraffin
Anti-CCR2 antibody IHC of human spleen, lymphocytes. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Monkey
Applications: IHC, IHC - Paraffin
Species: Rat, Human, Mouse
Applications: Western blot
CCR2 Antibody - Immunocytochemical analysis of CCR2 in NIH/3T3 cells.  This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Mouse, Human
Applications: ICC, Flow Cytometry

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Requested From: United States
Date Requested: 3/26/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy