Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C331195-20 20 µl (2.42 mg/ml) $263 
LS-C331195-50 50 µl $301 
LS-C331195-100 100 µl $359 
LS-C331195-200 200 µl (1.462 mg/ml) $473 
CCNH / Cyclin H Antibody - Immunofluorescence analysis of HeLa cells.
CCNH / Cyclin H Antibody - Immunofluorescence analysis of HeLa cells.
CCNH / Cyclin H Antibody - Western blot analysis of extracts of various cell lines, using CCNH antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
CCNH / Cyclin H Antibody - Western blot analysis of extracts of various cell lines.
CCNH / Cyclin H Antibody - Immunoprecipitation analysis of 200ug extracts of K562 cells using 1ug CCNH antibody. Western blot was performed from the immunoprecipitate using CCNH antibodyat a dilition of 1:1000.
CCNH / Cyclin H Antibody - Immunofluorescence analysis of HeLa cells.
CCNH / Cyclin H Antibody - Immunofluorescence analysis of HeLa cells.
CCNH / Cyclin H Antibody - Western blot analysis of extracts of various cell lines, using CCNH antibody. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection.
CCNH / Cyclin H Antibody - Western blot analysis of extracts of various cell lines.
CCNH / Cyclin H Antibody - Immunoprecipitation analysis of 200ug extracts of K562 cells using 1ug CCNH antibody. Western blot was performed from the immunoprecipitate using CCNH antibodyat a dilition of 1:1000.
1 of 5
2 of 5
3 of 5
4 of 5
5 of 5

Polyclonal Rabbit anti‑Human CCNH / Cyclin H Antibody (IF, WB) LS‑C331195

Polyclonal Rabbit anti‑Human CCNH / Cyclin H Antibody (IF, WB) LS‑C331195

Antibody:
CCNH / Cyclin H Rabbit anti-Human Polyclonal Antibody
Application:
IF, WB, IP
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C331195-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
CCNH / Cyclin H Rabbit anti-Human Polyclonal Antibody
Application:
IF, WB, IP
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
Cyclin H antibody LS-C331195 is an unconjugated rabbit polyclonal antibody to human Cyclin H (CCNH). Validated for IF, IP and WB. Cited in 2 publications.
Target
Human CCNH / Cyclin H
Synonyms
CCNH | Cyclin H | p34 | p37 | CAK | CAK complex subunit | Cyclin-H | MO15-associated protein
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human CCNH (NP_001230.1). MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Specificity
Human CCNH / Cyclin H
Applications
  • Immunofluorescence
  • Western blot (1:500 - 1:2000)
  • Immunoprecipitation (1:50 - 1:200)
Usage
The predicted MW is 37kDa, while the observed MW by Western blot was 36kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CCNH / Cyclin H
P51946 NM_001239 NP_001230.1

LSBio Ratings

CCNH / Cyclin H Antibody for IF/Immunofluorescence, WB/Western, IP LS-C331195 has an LSBio Rating of
Publications (4.1)

Publications (2)

Cyclins B1, T1, and H differ in their molecular mode of interaction with cytomegalovirus protein kinase pUL97. Steingruber M, Keller L, Socher E, Ferre S, Hesse AM, Couté Y, Hahn F, Büscher N, Plachter B, Sticht H, Marschall M. The Journal of biological chemistry. 2019 April;294:6188-6203.

Functional Relevance of the Interaction between Human Cyclins and the Cytomegalovirus-Encoded CDK-Like Protein Kinase pUL97. Martin Schütz, Mirjam Steingruber, Eileen Socher , Regina Müller, Sabrina Wagner, Merle Kögel, Heinrich Sticht, Manfred Marschall. Viruses. 2021 Jun;13:1248.

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 12/2/2022