Research Areas
Contact Us
Quick Order
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Contact Us
2401 Fourth Avenue Suite 900
Seattle WA 98121
How To Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues. - To request technical information about an LSBio product or its applications - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.

Fields marked with a * are required.

Quick Order
Catalog Number Size Price
LS-C334116-20 20 µl $263 
LS-C334116-50 50 µl $301 
LS-C334116-100 100 µl $359 
LS-C334116-200 200 µl $473 
CBX6 Antibody - Western blot analysis of extracts of HepG2 cells.

Polyclonal Rabbit anti‑Human CBX6 Antibody (WB) LS‑C334116

Polyclonal Rabbit anti‑Human CBX6 Antibody (WB) LS‑C334116

CBX6 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America
For Research Use Only


CBX6 Rabbit anti-Human Polyclonal Antibody
Human, Mouse, Rat
Unconjugated, Unmodified


CBX6 antibody LS-C334116 is an unconjugated rabbit polyclonal antibody to CBX6 from human. It is reactive with human, mouse and rat. Validated for WB.
Human CBX6
CBX6 | Chromobox homolog 6 | Chromobox protein homolog 6
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human CBX6 (NP_055107.3). LLKARAQAEALRISDVHFSVKPSASASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRNRIILNLKV
Human CBX6
  • Western blot (1:500 - 1:2000)
The predicted MW is 43kDa, while the observed MW by Western blot was 50kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only. Intended for use by laboratory professionals.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CBX6
O95503 NM_014292 NP_055107.3

Publications (0)

Customer Reviews (0)

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Requested From: United States
Date Requested: 11/27/2022