Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

CALCRL / CGRP Receptor Antibody

CGRP Receptor antibody LS-C410067 is an unconjugated rabbit polyclonal antibody to CGRP Receptor (CALCRL) from human, mouse and rat. Validated for WB.
50 µl
100 µl
200 µl
CGRP Receptor antibody LS-C410067 is an unconjugated rabbit polyclonal antibody to CGRP Receptor (CALCRL) from human, mouse and rat. Validated for WB.
Human CALCRL / CGRP Receptor
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Affinity purified
  • Western blot (1:500 - 1:2000)
Recombinant fusion protein containing a sequence corresponding to amino acids 392-461 of human CALCRL (NP_005786.1). QAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
Human CALCRL / CGRP Receptor
The predicted MW is 52kDa, while the observed MW by Western blot was 43kDa.
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
About CALCRL / CGRP Receptor
Q16602 NM_005795 NP_005786.1

Popular CALCRL / CGRP Receptor Products

Anti-CALCRL  / CGRP Receptor antibody IHC of human Lung, Non-Small Cell Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human, Monkey, Rat, Bovine, Dog, Goat, Hamster, Horse, Pig, Rabbit, Xenopus
Applications: IHC, IHC - Paraffin
Anti-CALCRL  / CGRP Receptor antibody IHC of human Lung, Non-Small Cell Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Species: Human
Applications: IHC, IHC - Paraffin
CALCRL antibody Western blot of Fetal Muscle lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.
Species: Human, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Rabbit
Applications: Western blot
Species: Rat, Human
Applications: Western blot, ELISA

Publications (0)

Customer Reviews (0)


Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Western blot

Western blot analysis of extracts of various cells.
Western blot analysis of extracts of various cells.

Requested From: United States
Date Requested: 1/23/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy