Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

BMP5 Antibody LS-C490362

1 of 4
2 of 4
3 of 4
4 of 4

BMP5 Antibody LS-C490362

Rabbit Polyclonal to Human BMP5
Human, Mouse, Rat
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human BMP5
Human, Mouse, Rat
Unconjugated, Unmodified


BMP5 antibody LS-C490362 is an unconjugated rabbit polyclonal antibody to BMP5 from human, mouse and rat. Validated for ELISA, IHC and WB.

Human BMP5
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
BMP5 antibody was raised against amino acids HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL of human BMP5 were used as the immunogen for the BMP5 antibody.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Reconstitute in sterile distilled water.
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About BMP5
P22003 NM_021073 NP_066551.1

Publications (0)

Reviews (0)

Featured Products

Reactivity: Human
Range: 0.156-10 ng/ml
Species: Human, Mouse, Rat
Applications: Western blot
Reactivity: Human
Range: 31.25-2000 pg/ml
Reactivity: Human
Range: 0.5-10 ng/ml

Requested From: United States
Date Requested: 6/18/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy