Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us
BMP5 Antibody (DY550) LS‑C756598
BMP5 antibody LS-C756598 is a DY550-conjugated rabbit polyclonal antibody to human BMP5. Validated for Flow.
100 µg
BMP5 antibody LS-C756598 is a DY550-conjugated rabbit polyclonal antibody to human BMP5. Validated for Flow.
Human BMP5
Human (tested or 100% immunogen sequence identity)
IgG Polyclonal
DyLight 550
Immunogen affinity purified
  • Flow Cytometry (1 - 3 µg/10E6 cells)
BMP5 antibody was raised against a synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
No cross reactivity with other proteins.
Applications should be user optimized.
0.2% Na2HPO4, 0.9% NaCl, 0.02% Sodium Azide, 50% Glycerol
Store at 4°C. Do not freeze. Protect from light.
For research use only.
About BMP5
P22003 NM_021073 NP_066551.1

Popular BMP5 Products

Anti-BMP5 antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 10 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, ELISA
Species: Human
Applications: Western blot
BMP5 antibody IHC-paraffin. IHC(P): Rat Lung Tissue.
Species: Human, Mouse, Rat, Bovine, Dog, Pig, Rabbit, Sheep
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Immunohistochemistry - Paraffin Image
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE)
Species: Human, Mouse, Rat, Pig, Chicken
Applications: IHC, IHC - Paraffin, Western blot

Publications (0)

Customer Reviews (0)

Requested From: United States
Date Requested: 12/18/2018
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy