Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

BMP4 Antibody LS-C490361

BMP4 Antibody LS-C490361

Rabbit Polyclonal to Human BMP4
Human, Mouse
Unconjugated, Unmodified
Catalog Number
Toll Free North America


Rabbit Polyclonal to Human BMP4
Human, Mouse
Unconjugated, Unmodified


BMP4 antibody LS-C490361 is an unconjugated rabbit polyclonal antibody to BMP4 from human and mouse. Validated for ELISA and WB.

Human BMP4
Human, Mouse (tested or 100% immunogen sequence identity)
IgG Polyclonal
Immunoaffinity purified
  • Western blot (0.1 - 0.5 µg/ml)
  • ELISA (0.1 - 0.5 µg/ml)
BMP4 antibody was raised against amino acids SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND of human BMP4 were used as the immunogen for the BMP4 antibody.
Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Sterile distilled water
Store at -20°C. Avoid freeze-thaw cycles.
For research use only.
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About BMP4
P12644 NM_001202 NP_001193.2

Publications (0)

Reviews (0)

Featured Products

Anti-SLC40A1 antibody IHC of human skeletal muscle. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 20 ug/ml.
Species: Human, Mouse
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Reactivity: Human
Range: 312-20000 pg/ml
Reactivity: All species
Range: 12.35-1000 ng/ml
Reactivity: Human
Range: 0.312-20 ng/ml

Requested From: United States
Date Requested: 5/26/2019
Get Social With Us!
Follow us on Facebook Follow us on LinkedIn
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy