Products
Research Areas
COVID-19
Resources
Contact Us
Distributors
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us
LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121
Phone:
206-374-1102
Fax:
206-577-4565
How To Buy - Details about how to buy our products.
Orders@LSBio.com - To submit a new order.
Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, Proforma invoice requests, or other billing issues.
Technical.Support@LSBio.com - To request technical information about an LSBio product or its applications
Sales@LSBio.com - To request information about distribution agreements, or general business development.
Worldwide Distributors List - To find your local distributor if you're not within the United States.
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C746869-20 20 µl $263 
LS-C746869-50 50 µl $301 
LS-C746869-100 100 µl $359 
LS-C746869-200 200 µl $473 
BDNF Antibody - Immunohistochemistry of paraffin-embedded mouse heart using BDNF antibody at dilution of 1:100 (40x lens).
BDNF Antibody - Immunohistochemistry of paraffin-embedded rat heart using BDNF antibody at dilution of 1:100 (40x lens).
BDNF Antibody - Immunohistochemistry of paraffin-embedded rat brain using BDNF antibody at dilution of 1:100 (40x lens).
BDNF Antibody - Immunofluorescence analysis of U-251MG cells using BDNF antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
BDNF Antibody - Immunohistochemistry of paraffin-embedded mouse heart using BDNF antibody at dilution of 1:100 (40x lens).
BDNF Antibody - Immunohistochemistry of paraffin-embedded rat heart using BDNF antibody at dilution of 1:100 (40x lens).
BDNF Antibody - Immunohistochemistry of paraffin-embedded rat brain using BDNF antibody at dilution of 1:100 (40x lens).
BDNF Antibody - Immunofluorescence analysis of U-251MG cells using BDNF antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
1 of 4
2 of 4
3 of 4
4 of 4

Polyclonal Rabbit anti‑Human BDNF Antibody (IHC, IF) LS‑C746869

Polyclonal Rabbit anti‑Human BDNF Antibody (IHC, IF) LS‑C746869

Antibody:
BDNF Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$263
LS-C746869-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
BDNF Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IF
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
BDNF antibody LS-C746869 is an unconjugated rabbit polyclonal antibody to BDNF from human. It is reactive with human, mouse and rat. Validated for IF and IHC.
Target
Human BDNF
Synonyms
BDNF | ANON2 | Abrineurin | BULN2 | Neurotrophin
Host
Rabbit
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG Polyclonal
Conjugations
Unconjugated
Purification
Affinity purified
Modifications
Unmodified
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-247 of human BDNF (NP_733928.1). PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Applications
  • IHC (1:50 - 1:200)
  • Immunofluorescence (1:50 - 1:100)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
The predicted MW is 27kDa/28kDa/29kDa/31kDa/37kDa.
Presentation
PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Storage
Store at -20°C. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About BDNF
P23560 NM_001709 NP_001700.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 10/4/2022