Research Areas
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products. - To submit a new order. - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues. - To request technical information requests about an LSBio product or its application. - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Research Areas
Contact Us

ATP2A3 / SERCA3 Antibody (aa1-30) LS-C357603

Note: This antibody replaces LS-C388042
SERCA3 antibody LS-C357603 is an unconjugated rabbit polyclonal antibody to SERCA3 (ATP2A3) from human, mouse, rat and other species. Validated for IHC and WB.
100 µg (0.5 mg/ml)
SERCA3 antibody LS-C357603 is an unconjugated rabbit polyclonal antibody to SERCA3 (ATP2A3) from human, mouse, rat and other species. Validated for IHC and WB.
Human ATP2A3 / SERCA3
Human, Mouse, Rat, Rabbit (tested or 100% immunogen sequence identity)
Immunogen affinity purified
  • IHC
  • IHC - Paraffin
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
ATP2A3 / SERCA3 antibody was raised against a synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines. .
Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
200 µl Distilled water
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
For research use only.
About ATP2A3 / SERCA3
Q93084 NM_005173 NP_005164.2

Popular ATP2A3 / SERCA3 Products

Anti-ATP2A3 / SERCA3 antibody IHC of human brain, cerebellum. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Species: Human
Applications: IHC, Western blot, Immunoprecipitation, ELISA
Antibody staining ATP2A3 in human brain tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with formaldehyde and blocked with 3% BSA for 0. 5 hour at room temperature; antigen retrieval was by heat mediation with a citrate buffer (pH 6). Samples were incubated with primary antibody (1:25) for 1 hours at 37°C. A undiluted biotinylated goat polyvalent antibody was used as the secondary antibody.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Immunohistochemistry of paraffin-embedded Human brain using ATP2A3 Polyclonal Antibody at dilution of 1:30.
Species: Human, Mouse, Rat
Applications: IHC, ELISA

Publications (0)

Customer Reviews (0)



ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.
ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.


ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.
ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.

Western blot

ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.
ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.


ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.
ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.


ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.
ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.

Western blot

ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.
ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.


ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.
ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.


ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.
ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.

Western blot

ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.
ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.


ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.
ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.


ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.
ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.

Western blot

ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.
ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.

Requested From: United States
Date Requested: 4/23/2019
Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2019 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy