LSBio
LSBio
Products
Services
Research Areas
Resources
Contact Us
Work with LifeSpan to design a custom immunohistochemistry to address your specific biological question. Outsource the entire localization process without having to worry about finding and characterizing target specific antibodies, sourcing and validating difficult-to-find tissues, and having the ability to interpret the resulting immunostaining in relation to complex human pathologies.

Test your therapeutic antibodies in immunohistochemistry against a broad panel of normal frozen human tissue types in order to determine potential unintended binding. Our non-GLP TCR services are designed on the FDA recommendation outlined in their "Points to Consider in the Manufacture and Testing of Monoclonal Antibody Products for Human Use".

LSBio
2401 Fourth Avenue Suite 900
Seattle WA 98121

Phone: 866-819-4732 (Toll Free North America)
206-374-1102 (International)

Fax: 866-206-6909 (Toll Free North America)
206-577-4565 (International)

How to Buy - Details about how to buy our products.

Orders@LSBio.com - To submit a new order.

Customer.Support@LSBio.com - To submit questions about existing orders, pricing, availability, bulk quotes, proforma invoice requests, or other billing issues.

Technical.Support@LSBio.com - To request technical information requests about an LSBio product or its application.

Sales@LSBio.com - To request information about fee-for-service contract IHC studies, IHC reports, distribution agreements, or general business development.

Worldwide Distributors List - To find your local distributor if you're not within the United States.
Products
Services
Research Areas
Resources
Contact Us
ATP2A3 / SERCA3 Antibody (aa1‑30) LS‑C357603
Note: This antibody replaces LS-C388042
SERCA3 antibody LS-C357603 is an unconjugated rabbit polyclonal antibody to SERCA3 (ATP2A3) from human, mouse, rat and other species. Validated for IHC and WB.
Catalog
Size
Price
LS-C357603-100
100 µg (0.5 mg/ml)
$355

Popular ATP2A3 / SERCA3 Products

Anti-ATP2A3 / SERCA3 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, ELISA
Antibody
Species: Human
Applications: IHC, Western blot, Immunoprecipitation, ELISA
Antibody staining ATP2A3 in human brain tissue sections by Immunohistochemistry (IHC-P - paraformaldehyde-fixed, paraffin-embedded sections). Tissue was fixed with formaldehyde and blocked with 3% BSA for 0. 5 hour at room temperature; antigen retrieval was by heat mediation with a citrate buffer (pH 6). Samples were incubated with primary antibody (1:25) for 1 hours at 37°C. A undiluted biotinylated goat polyvalent antibody was used as the secondary antibody.
Species: Human
Applications: IHC, IHC - Paraffin, Western blot, Peptide Enzyme-Linked Immunosorbent Assay
Immunohistochemistry of Human brain using ATP2A3 Polyclonal Antibody at dilution of 1:30.
Species: Human, Mouse, Rat
Applications: IHC, ELISA

Product Description

SERCA3 antibody LS-C357603 is an unconjugated rabbit polyclonal antibody to SERCA3 (ATP2A3) from human, mouse, rat and other species. Validated for IHC and WB.

Specifications

Target
Human ATP2A3 / SERCA3
Synonyms
ATP2A3, Calcium pump 3, SERCA3, SR Ca(2+)-ATPase 3, SERCA3b
Host
Rabbit
Reactivity
Human, Mouse, Rat, Rabbit (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Applications
  • IHC
  • IHC - Paraffin
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Immunogen
ATP2A3 / SERCA3 antibody was raised against a synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.
Epitope
aa1-30
Specificity
Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. Expressed in cell lineages of hematopoietic, epithelial, or embryonic origin and also expressed in several cancer cell lines. .
Presentation
Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
Reconstitution
200 µl Distilled water
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
Restrictions
For research use only.
About ATP2A3 / SERCA3
This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. Q93084 NM_005173 NP_005164.2


Publications (0)


Customer Reviews (0)


Images

Immunohistochemistry

ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.
ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.

Immunohistochemistry

ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.
ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.

Western blot

ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.
ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.

Immunohistochemistry

ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.
ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.

Immunohistochemistry

ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.
ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.

Western blot

ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.
ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.

Immunohistochemistry

ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.
ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.

Immunohistochemistry

ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.
ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.

Western blot

ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.
ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.

Immunohistochemistry

ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.
ATP2A3 antibody IHC-paraffin. IHC(P): Rat Thymus Tissue.

Immunohistochemistry

ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.
ATP2A3 antibody IHC-paraffin: Mouse Thymus Tissue.

Western blot

ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.
ATP2A3 antibody Western blot. All lanes: Anti ATP2A3 at 0.5 ug/ml. Lane 1: Rat Skeletal Muscle Tissue Lysate at 50 ug. Lane 2: Mouse Skeletal Muscle Tissue Lysate at 50 ug. Predicted band size: 114 kD. Observed band size: 114 kD.

Requested From: United States
Date Requested: 11/12/2018

Get Social With Us!
Follow us on Facebook Follow us on Google+ Follow us on LinkedIn PSL Alliance Member
Copyright © 2018 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy